Thread Rating:
  • 0 Vote(s) - 0 Average
  • 1
  • 2
  • 3
  • 4
  • 5
Optiwave OptiSystem 2026 v23.0
#1
Most cracked softwares are here to website download, pls Ctrl + F to search them.
Full cracked version, full function, no termination time.
Any softwares you need, just need to mail: store0065#hotmail.com change # into @


Adobe Substance 3D Designer 15.1.1 x64 win/mac x64
Adobe Substance 3D Modeler v1.22.6 (x64)
Adobe Substance 3D Painter 11.1.2 x64 win/mac
Adobe Substance 3D Sampler 5.1.3 x64 win/mac
Adobe Substance 3D Stager 3.1.7
adpss 3.1
Air Quality Calculator 1.0.1
Akcelik SIDRA Intersection 2025 v10.0.6.236
Aldec ALINT-PRO 2025.12
Altair Analytics Workbench 2026.0 Win/Linux
Altair Compose 2026.0 Linux64
Altair EDEM Professional 2026.0 x64
Altair Embed 2026.0 x64
Altair FEKO 2026.0 x64
Altair Flux & FluxMotor 2026.0 x64
Altair GateVision PRO 2026.0 Win/Linux64
Altair Grid Engine 2026.0 Linux
Altair HW FEKO 2026.0 x64
Altair HWDesktop 2026.0.1 x64
Altair HyperWorks Desktop 2026.0.1 x64 + Solvers + Help
Altair Inspire 2026.0 x64
Altair Inspire Cast 2026.0 x64
Altair Inspire Extrude 2026.0 x64
Altair Inspire Form 2026.0 x64
Altair Inspire Mold 2026.0 x64
Altair Inspire PolyFoam 2026.0 x64
Altair OmniV 2026.0
Altair PollEx 2026.0 x64
Altair Pulse 2025.1
Altair RTLVision PRO 2026.0 Win/Linux64
Altair S-Frame Suite 2026.0
Altair SimLab 2026.0 Linux64
Altair SimSolid 2026.0 x64
Altair SpiceVision PRO 2026.0 Win/Linux64
Altair StarVision PRO 2026.0 Win/Linux64
Altair Sulis 1.12
Altair Twin Activate 2026.0 x64
Altium Designer 26.2.0.7 x64
AltoQi Builder + Eberick 2025.04
AMETank 18.12.06
Analyst 1.7.4
ANSYS Clock FX 2025R2.2 Linux64
ANSYS Diakopto 2025R2.2 Linux64
ANSYS Electromagnetics Suite 2025R1 Linux64
ANSYS Helic 2025R2.2 Linux64
ANSYS Lumerical Suite 2025R1 Linux64
ANSYS Path FX 2025R2.2 Linux64
ANSYS PathFinder-SC 2025R2.2 Linux64
ANSYS PowerArtist 2025R2 Linux64
ANSYS Redhawk-SC 2025R2.2 Linux64
ANSYS SCADE19
ANSYS SeaScape 2025R2.2 Linux64
Ansys Systems Tool Kit (STK) Pro Premium 2025 v13.0 x64
ANSYS Thermal Desktop 2025 R2
ANSYS Totem-SC 2025R2.2 Linux64
AnyDWG Software DGN to DWG Converter 2027.0
AnyDWG Software DWG DXF Converter 2027.0
AnyDWG Software DWG to DWF Converter 2027.0
AnyDWG Software DWG to SVG Converter 2027.0
AnyDWG Software PDF to DWG Converter Full 2027.0
anyLogistix Professional 2026 v3.4.2
ANY-maze 7.61
AnyRail 7.140
Applied Imagery Quick Terrain Modeler 8.4.4
Aquaveo Groundwater Modeling System Premium v10.9.2 Win64
Aquaveo Watershed Modeling System v11.3.6
Arena Simulation Pro 16.1
ARES Commander 26.3.1.4145 x64
Artifact Interactive Garden Planner 3.8.82
ASDIP Steel/Foundation/Concrete/Retain/Wood 2026
ASDIP.Wood.v.3.3.2.2
AspenTech aspenONE Suite 2025 v15.0
AtaiTec SI Suite 2025.12
Autodesk AutoCAD 2025.1.2 (x64) win/mac
Autodesk EAGLE Premium 9.6.2
AutoDWG DWGSee Pro 2027 v6.61
AutoForm Forming R13.0.1
AVEVA E3D Design (Everything3D) 2025 v3.1.10
AVEVA Marine 12.1 SP4.64
AVEVA Production Accounting 2025.2
Awesome Miner Ultimate 11.3.4
AWR Design Environment 25.10.030
BETA-CAE Systems 25.2.0 x64
BIMware MASTER EC2 Reinforcement 2026 15.2.0
BIMware MASTER EC3 Steel Connections v15.2.0
biowin 6.4
BOSpulse 6.0.1
BowTieXP 12.0.8
Bricsys BricsCAD Ultimate 26.1.08 x64 win/mac
Bricsys PowerPath v25.2.08
C3D Labs CADEX CAD Exchanger v3.24.16
Cabinet Vision 2025.4
Cabmaster v2025
Cadaplus APLUS v25.113
Cadence AWR Design Environment v25.10.030 Win64
Cadence CONFRML 25.1 Linux
Cadence Design Systems Analysis Sigrity 2025 25.10.000/ 2024
Cadence Digital Design Implementation (DDI) System 25.11.001
Cadence Fine/Marine 2025.1 Linux64
Cadence QUANTUS 25.1 Linux
Cadence System Analysis Sigrity 2025 v25.10.000 & HF010 25.10.100 Win64
Cadence Virtuoso Studio IC25.10 (25.10.000) Linux
Cadfil 9.84
CadnaA 2023
Cameo Enterprise Architecture 2026x Hotfix1
CAMMaster Designer v11.24.73
CAMWorks 2026 SP0 x64
CAMWorks ShopFloor 2026 SP0
Carbon Footprint Check 1.0.1
Carlson MapWorks v14.0.1.1
Carlson Precision3D 2025
Carlson Survey OEM 2026
Carlson ToolPac v25.0.1.0
Carlson WD2CAD v4.3.1.6
Carlson XL2CAD v8.3.1.8
CATALYST 3.3
CATIA V5-6R2023 (V5R33) SP4 Win64
CentOS8.5 EDA-vm 2025
Certara Phoenix 2026 v8.7.0
CFTurbo v2026 R1.1.128 + CFTurbo FEA v2026 R1.0 x64
CGSim 11.1
Chaos Vantage 3.1.1 x64
CHECKSTEEL v4.1.6
CHECKWIND v8.4.2
Chemcraft 1.8 Build 762b 2025
Chessbase 26.5
CityEditor for SketchUp 4.1.0
CLC Genomics Workbench Premium 26.0.1 Win/Linux
Cloanto Amiga Forever Plus Edition 11.2.4
Cloanto C64 Forever 11.2.23Plus Edition
COAA PlanePlotter 6.7.4.1
ComPhysics E2M-Win Professional v1.0.1 x64
CONVERGE CFD Bundle 5.1.1
Converge Studio 5.1.1
CoPRA 13.1.1
COSMOlogic COSMOthermX 19.0.4 & TmoleX 4.5.3
Coventor SEMulator3D 11.2 x64
CPFD Barracuda Virtual Reactor 25.1.1
Cradle CFD 2025.1
Crosslight 2024
CSI Bridge Advanced with Rating v26.3.0 build 3324 (x64)
CSI CSiCol v12.0.0 build 1206
CSI ETABS v23.1.1 build 4293 Win64
CSI Perform3D 11.0.0
CSI SAFE 23.1.1
CSI.XRevit.2026.0.238
CST Studio Suite 2026 SP1
CurveExpert_Pro_2.6.5_x64
-customcompiler 2024.09, dve 2025.06, license
Cutting Optimization Pro 5.18.19.3
Cyclone 3DR v.2026.0.0.49047
Cyclone FIELD 360
Dassault Systemes SIMULIA CST Studio Suite 2026 Win64
Datamine PA Explorer 2025_20.0.13
DAZ Studio Professional 4.24.0.4
DecisionTools Suite Industrial 8.12
Deep Excavation HelixPile 2025 v25.0.5.4
Deep Excavation PileDVR 2019 v19.0.1.1
Deep Excavation QuayWalls 2025 v25.0.11.1
Deep Excavation RetainEX 2025 v25.0.7.7
Deform 14.0
DesignBuilder 2025.1
Design-Expert 13.0.5.0 x64
Deswik Nova 2025.6
Diamond Cut Forensics Audio Laboratory v11.09
Dirac 3.0
DNV GeniE 2025 v9.0
DNV GL Phast Safeti v9.11
DNV GL SIMA 4.8
DNV HydroD 2025 v8.0
DNV Nauticus Machinery 2026 v16.0.0
DNV Phast&Safeti 2025 v9.11.0
DNV Sesam Wind Manager 2025 v8.0
DNVGL Leak 3.3
DNVGL Maros 9.3.1
DNVGL Nauticus Hull FEA 2025 v20.30
DNVGL Nauticus Hull Prescriptive 2025 v20.30
DNVGL Nauticus Machinery 2026 v15.0
DNVGL Phast&Safeti 9.11.0
DNVGL Sesam GeniE 8.12-03
DNVGL Sesam HydroD 7.3-01
DNVGL Sesam Jacket Design 2025
DNVGL Sesam Marine 2025
DNVGL Sesam Package 2025
DNVGL Sesam Pipeline Tools 2025
DNVGL Sesam Topside Design 2025
DNVGL Sesam Wind Manager 7.2-00
DNVGL Sima 4.8.0
DNVGL Synergi Plant RBI Onshore 5.6
DNVGL Tero 5.3.1
Draftable Desktop 26.1.0
DS CATIA P3 V5-6R2023 SP4 x64
DS SIMULIA CST Studio Suite 2026 SP1 x64
DS Simulia XFlow 2026 Build 124.01 x64
DS SolidWorks 2026 SP1.1 x64
-dve2024.09,license
Dynamic_Web_TWAIN_17.2.1
Dynamita SUMO v24.0.1
EcoStruxure Control Expert v16.2
Edwards PumpCalc 5.4
EEMS 12.4 (EFDC+Explorer 12.4.1+Grid1.2)
EFI Fiery XF 9.0
EIVA NaviCat 4.10.0
EIVA NaviEdit 9.2.0
EIVA NaviScan 9.10.0
EIVA Workflow Manager 4.10.0
Ekahau AI Pro 11.8.8
Elasticsearch Enterprise 9.2.4 Win/Mac/Linux
EngiCalc - Engineering Calculator 1.0.1
Environment And Climate Prediction AI 1.0.0
Environmental Calculator 1.0.1
EnviroSim BioWin 2025 v6.4.3
EPLAN Electric P8 v2026.0.3.371
EPLAN Harness proD 2023.0.0.257 x64
ErgoLAB 3.17
Eriksson Technologies ETPier 2.61
ESG Climate Risks Engine 1.0.0
ESI ProCAST Suite 2025.0
ESRI ArcGIS Pro 3.6 Patch 1
Essential Macleod 11.9
Etap.PowerStation.v24.0.1.Win64
EViews 14
EVS(Earth Volumetric Studio 2026)2026.1.0
FactSage 8.3
faro cam2 10.6
FARO SCENE 2025 2025.2.1
FIFTY2 PeronLab 2026 v7.0.3
Filou NC Gorilla 2026.11.19
-fm2024.09, icc2 2024.09, spyglass2024.09, dc2024.09
Fritz 20.9
Frontline Excel Slver 2025
Frontline InCAM Pro 6.1
-fusioncomplier2024.09, customcompiler 2024.09
Futuremark 3DMark Professional 2.32.8826
FX Math Tools v26.01.14 x64
FX Science Tools v26.01.14 x64
gasturb 14
Geo magic design
Geoactive Interactive Petrophysics 2025.3.2
GeoGebra 6.0.913.0
Geometric.Glovius.Prime.6.7.0.121.Win64
Geomur
GEOVIA MineSched 2026 v9.11.0
GEOVIA Surpac 2026 x64
GEOVIA Whittle 2026
GibbsCAM 2026 v26.0.55.0 x64
Golden Software Grapher v26.1.314 2026
Golden Software Surfer v30.3.273 2026
Graebert.ARES.Commander.2026.SP3
Graitec BIMware Master 2025 v15.2
Graitec Master Suite (BIMware MASTER Suite) 2026 x64
Greenhills multi 2023 RH850/PPC/ARM/RISC/TRICORE/MIP
GreenPower Designer 1.0.1
GrindEQ Math Utilities 2024
guidemia 7.0
HelixQAC 2024.2
Hexagon PV Elite 2025 v28.0
Hexagon.Intergraph.PepS(PIPESTRESS).2025.v08.00.00
HxGN MinePlan 2025.1 Release 1 x64
Hydromantis CapdetWorks 2025 v5.0
Hydromantis GPS-X 8.0.1 / Toxchem 4.3.6 / CapdetWorks / WatPro 4.0
Hydromantis GPS-X 9.0.5
Hydromantis Toxchem 2025 v5.0
Hydromantis WatPro 2025 v5.0
IAR Visual State 11.2.3
iBwave Design Enterprise 24.1.0.25
-IC(virtuoso)231.60, SPECTRE231, ASSURA41_231, XCELIUM2403
-IC(virtuoso)251, SPECTRE241, XCELIUM2403, license
-icc2 2025.06, spyalass2025.06, dc2025.06, lc2025.06,
IES ConcreteBending v8.00.0002
IES ConcreteSection v4.00.0003
IES QuickConcreteWall v5.0.0016
IES QuickFooting v5.0.0017
IES QuickMasonry v6.0.0008
IES QuickRWall v5.0.0017
IES ShapeBuilder v15.00.0001
IES VAConnect v7.00.0005
IES VisualAnalysis v23.00.0003
IES VisualFoundation v13.00.0002
IES VisualPlate v7.00.0002
IHS Kingdom Advanced 2025SP1 v19.1
Inertial Explorer 2025 v10.00
Intel Quartus Prime Pro 25.3 (x64)
Interaction Design Lab Potsdam Fritzing v1.0.6 Win64
Interactive Petrophysics 2025
IPG Carmaker 12.0.1
IQSTAR 1.2
Irazu 6.3 2D/3D
Itasca software (pfc3d/3dec/flac3d/massflow) 9.10.7
iTwin Capture Manage and Extract 25.00.03.02
Jason 2025
Jeppesen Cycle DVD 2603 Full World
JMatPro 14.1
kappa workstation 5.40 +Emeraude
Keysight EXata (Scalable EXata) Network Modeling 8.3.1 Win/Linux64
Keysight Exata 8.3.1 2025
Keysight Model Builder Program (MBP) 2026.0 Win/Linux
Keysight Modeling MQA 2025U1
Keysight N1500A Materials Measurement Suite 2020
Keysight PathWave Vector Signal Analysis(89600 VSA) 2026
Keysight Physical Layer Test System(PLTS) 2025
KFX EXSIM 7.0
KiCad 9.0.7
Klocwork 12.3
Kongsberg K-Spice 2026 v25.6
Kongsberg LedaFlow Engineering 2026 v2.12
Krita Studio 5.2.15 x64
LDRA TestBed 9.8.1
Leica CloudWorx 2025.x for AutoCAD 2023-2026
Leica CloudWorx 2025.x for BricsCAD 22-26
Leica CloudWorx 2025.x for MicroStation 2023-2025
Leica CloudWorx 2025.x for Navisworks 2023-2026
Leica CloudWorx 2025.x For PDMS 12.1 SP4
Leica CloudWorx 2025.x For Revit 2023-2026
Leica CloudWorx 2025.x for Solidworks 2019-2024
Leica Cyclone 3DR v2026.0.0.49047
Leica Cyclone Enterprise v2025.0
Leica Cyclone HxMap 2025 v4.8
Leica Infinity 2025 v5.0.0
Leica PinPoint 4.4.1
Leica XPro 6.4.7В
Let It Be Light 2.0.12
LightBurn v2.0.05
LightTools 2025.3
Limaguide Plus 2025
LimitState RING v4.2.0.34975
LiPowerline 9.0
Lloyd's Register (ex. Senergy) Interactive Petrophysics 2025 v25.3.2
Lloyd's Register (ex. Senergy) IP 2025 v25.3.2
LuBan 3D 04.01.2026
LucidShape 2024
MagiCAD 2026 UR-2 for AutoCAD / Revit 2021-2026
Maptek PointStudio 2023
Maptek Vulcan 2025.3 x64
Maptek Workbench 2025.1
MASTA 14.0
Materialise 3-matic (Medical) 2026 v20.0
Materialise e-Stage 2025 v8.0
Materialise Magics 29.1.1
Materialise Mimics Core (Medical) 2026 v28.0
MathWorks MATLAB R2025b v25.2.0.2998904 x64 Win
MaxCut Business Edition 2.9.6.3
Maxon CINEMA 4D 2026.1.2 x64
Maxqda 26
MAXQDA Analytics Pro R26.0.0 x64
MecSoft RhinoCAM 2025 15.0.179 for Rhinoceros 8
-Mentor calibre 2024.2
Meteodyn WT 6.9.1
Metre2 Takeoff Studio Pro 1.1.5
MICRESS 7.2
Millbox 2025
MillBox DGSHAPE Edition V25.1.2
MITCalc v2.04
Molsoft ICM-Pro 3.9-4a x64
Multiecuscan 5.3R1
Multiquant 3.0.3
nanoSoft nanoCAD Scan 2025 v25.0.6962.4768 build 8019
NAPA 2024.2
NAPA designer 2025.1
NBL Landscape Designer 2025 25.0.5
NCSS Pro 2026 v26.0.1 x64
neostampa 25.12.1
NeuroScore 3.6
NijiCraft NijiCAD Pro v1.2.3
Normal Blood Parameters 1.0.1
NOZZLE PRO V25
nTopology 5.39.2 x64
Nubigon pro 7.3.2
Nucleomatica iNMR 7.0.5
ODEON 19.02 Combined
OkMap Desktop 19.3.0 x64
OneSphere Technologies Pharmacy System 1.2.1.0 x64
OpenTower Designer 2024 (24.00.01.12)
Operant Peak Spectroscopy 4.00.544
OptiLayer V2025.12
OPTIMOOR v6.8
Optiwave OptiSystem 2026 v23.0
orcaFlex 11.6a
ORS Dragonfly 3d 2025.1
Palisade Risk Platform (DecisionTools Suite) 2025 v8.12
Pandat 2025
ParkSEIS 3.0
PASS START-PROF V4.87 R2 2025
Peloton WellView 9.0
PentaLogix CAMMaster Designer 11.24.73
PentaLogix ViewMate Pro 11.24.74
Pepakura Designer 6.1.4
Petroleum experts IPM Suite 13.5
phapro 8.21
PhotoPrint 25.3
PhysiCalc Pro 1.0.1
PIPE-FLO Professional
PIPESTRESS 2025
Pixologic Zbrush 2026.1.1 x64 win+mac
Plato 7.1
PointCab 4Archicad 3.0R2
PointCab 4BricsCAD 3.0
Polar Instruments Si9000e 2025 v25.01
Polar Instruments Speedstack 2025 v25.01
Pospac mms 9.4
Power Path (Power Line Design Software) 25.2 - 2025
-primewave2024.09, lc2024.09, sc12024.06, prime2024.09
ProfiCAD v13.4.2
progeCAD 2026 Professional 26.0.10.10 (x64)
Progenesis QI 2.4
ProMax 6.0
PSASP 7.95
PSC SmartCtrl 2025.1
PSD-PEBL 2025
PTC Creo 11.0.7 x64 Multilingual
PV Elite 28.0 2026 ASME 2025
qbasePlus_3.2_x64
Q-Dir 12.45
QForm UK 11.2
qinsy 2.7.10
Ranplan wirless pro 6.9
rapidlasso LAStools Suite 2025 build 23122025
Raqsoft YModel 1.3.8 Release 20260108 x64
RealWorks 2026.10
Remcom Wireless Insite 2025 v4.0
Remcom XGtd 3.1.2
Revive Faces 2.0.12
Revolutio CHECKPOLE v11.2.10, CHECKSTEEL v4.1.6, CHECKWIND v8.4.2
Robert McNeel & Associates Rhinoceros 8 SR27 v8.27.26019.1602
RoboDK x64 v5.9.6.25622 2026
RockWare PetraSim 2025.2
RockWare RockWorks 2025.7.31
Rocscience Phase2 v8.024
ROHR2 v33.1
Room Arranger 10.3.3.741
S.S. Papadopulos & Associates GroundWater Desktop v5.2.35
SAi Flexi 25.3
SAI Production Manager 25.3
Sante PACS Server PG v4.4.4
SAPIEN PowerShell Studio 2026 5.10.263 x64
SAPIEN Primalscript 2026 v8.1.223 x64
Scale Photo Up 2.0.12
SCC-64 v15.8.1
Schlumberger OLGA 2026.1.0
Schlumberger Pipesim 2026.1.0
Sciex Analyst 1.7.3
Sciex OS 4.0
-scl2025.03, prime2025.06, fusioncomplier 2025.06
Seequent Leapfrog Geo/Works/Energy 2025.3.0
Seequent Res3DInv Res2DInv 2025
sentaurus 2025 TCAD linux
Sentaurus vX-2025.09
SES CDEGS Suite 20.0
SETCAD EDS PRO 4.0.0.16
SFTC DEFORM-2D/3D PREMIER14
Siemens Aprisa 2025.4 Linux
Siemens Calibre 2024.1 (15.1) linux
Siemens Custom IC(TannerTools) 2025.4 Win64/Linux64
Siemens Designcenter NX 2512.3200
Siemens mPower 2025.4 Linux
Siemens NX 2506 Build 8101 (NX 2506 Series)
Siemens Precision 2025.1 Linux
Siemens Solid Edge 2026 MP02 x64
Siemens Solido Characterization Suite 2025.3.1 Linux
Siemens Solido Design Environment 2025.2.3 Linux
Siemens Solido IP Validation Suite 2025.3 Linux
Siemens Solido Simulation Suite 2025.3 Linux
Siemens Tessent 2025.1 Linux
Sigasi Visual HDL Enterprise Edition 2025.3
silvaco TCAD 2025
SimaPro Craft 10.1.0.4 Developer Edition
simerics mp+ 6.1.1 2025
SIMetrix 9.10w
Simio Enterprise Edition v19.280.48282 x64
Simio RPS Edition 2025 v19.280
SimulationsPlus GastroPlus 10.1
SIMULIA PowerACOUSTICS 2026.0 Win/Linux64
SIMULIA PowerDELTA 2026.0 Win/Linux64
SIMULIA PowerFLOW suite 2026.0 Win64/Linux64
SIMULIA WASP-NET 2026.0
SIMULIA XFlow 2026.0 Win64/Linux64
SINT Srl XGSLab Pro 2025.1.9
SkyCAD Electrical Pro 1.3.64.19355
SmartCtrl Pro 2025.1
SoftGenetics Mutation Surveyor 5.1.2
Soil Quality Test 1.0.1
SolidWorks 2026 SP1.1 Full Premium x64
Sonnet Suites 19.52
SoundPLAN 9.1 2025
SpatialAnalyzer Ultimate 2025.1
SPEAG SEMCAD X Matterhorn 20.2.4
SpinFire Insight 2025.3.0 x64
SprutCAM ENCY 2025
SSI ShipConstructor 2026R3
Stampack Xpress 2025
Steel&Graphics TecnoMETAL 2022 build 22.0
Sumo v24.0.1
Sustainability Learning Dashboard 1.0.0
Synopsys QuantumATK V-2025.06
Synopsys 3DIC Compiler 2025.06
Synopsys Avalon 2025.06
Synopsys Certitude 2025.06
Synopsys Chamber Matching 2025.06
Synopsys CODE V 2025.06
Synopsys Core Synthesis Tools W-2024.09-SP1 Linux
Synopsys coreTools 2025.06
Synopsys Custom Compiler 2025.06-SP1 Linux
Synopsys Custom WaveView ADV 2025.06 Win/Linux64
Synopsys CustomCompiler vX-2025.06 Linux
Synopsys DSO.ai (Design Space Optimization AI) vX-2025.06
Synopsys DVE 2025.06
Synopsys Embedit 2025.06
Synopsys ESP 2025.06
Synopsys Euclide 2025.06
Synopsys FineSim 2025.06
Synopsys Formality 2025.06
Synopsys Fusion Compiler 2025.06
Synopsys HSPICE 2025.06
Synopsys IC Compiler 2025.06
Synopsys IC Compiler II 2025.06
Synopsys IC Validator Workbench 2025.06
Synopsys ICE Speed Adaptor 2025.06
Synopsys Laker OA 2025.06
Synopsys LibCompiler vX-2025.06 Linux
Synopsys Library Compiler 2025.06-SP3
Synopsys LightTools 2025.03
Synopsys LucidDrive 2024.03
Synopsys LucidShape 2025.06
Synopsys LucidShape CAA V5 Based 2025.06
Synopsys Milkyway Environment 2025.06
Synopsys NanoTime 2025.06
Synopsys PowerReplay 2025.06
Synopsys PrimeClosure 2025.06
Synopsys Primeclosure vX-2025.06 SP1 Linux64
Synopsys PrimeLib 2025.06
Synopsys PrimePower RTL 2025.06
Synopsys PrimeShield 2025.06
Synopsys PrimeSim Continuum(PrimeSim XA) 2025.06
Synopsys PrimeSim HSPICE 2025.06 Win/Linux
Synopsys PrimeSim XA vX-2025.06 Linux
Synopsys PrimeTime Suite 2025.06
Synopsys PrimeWave 2025.06(need Custom Compiler 2025.06)
Synopsys PrimeWave Design Environment 2024.09
Synopsys ProGen 2025.06
Synopsys Proteus 2025.06
Synopsys ProteusWorkbench 2025.06
Synopsys PS Photonic System Tools 2025.06
Synopsys PS PIC Design Suite 2025.06
Synopsys PS RSoft Photonic Device Tools 2025.06
Synopsys PyCell Studio 2025.06
Synopsys QuantumATK vX-2025.05 Linux
Synopsys QuantumATK vX-2025.06 Win64
Synopsys Quickcap vX-2025.06 Linux
Synopsys Raphael FX 2025.06
Synopsys RTL Architect 2025.06
Synopsys Saber 2025.06
Synopsys SaberRD 2025.06
Synopsys Sentaurus Process Explorer 2025.06
Synopsys Silicon WorkBench 2025.06
Synopsys SiliconSmart ACE 2025.06
Synopsys Simpleware 2025.06
Synopsys S-Litho 2025.06
Synopsys S-Metro 2025.06
Synopsys SpyGlass vX-2025.06 SP1 Linux64
Synopsys StarRC 2025.06
Synopsys Synplify FPGA Design 2025.09
Synopsys Synthesis(Design Compiler) 2025.06
Synopsys System Studio 20245.06
Synopsys TCAD Sentaurus 2025.06
Synopsys TCAD Sentaurus PCM Studio 2025.06
Synopsys Testmax ale vX-2025.06 SP3 Linux
Synopsys TestMAX Manager 2025.06
Synopsys TetraMAX ATPG 2025.06
Synopsys Timing Constraints Manager 2025.06
Synopsys TweakerSuite 2025.06
Synopsys VC SpyGlass 2025.06
Synopsys VCS All 2025.06
Synopsys VCS Verilog Simulator vX-2025.06
Synopsys Verdi vX-2025.06 Linux
Synopsys virtual_proto 2025
-Synopsys:
Tajima DG17 by Pulse
Tech Earth Volumetric Studio 2026.1
Tech Soft 3D SpinFire Insight 2025.3.0
TechnoSoft AMETank 14.3.11
Tecplot 360ex + Chorus 2025 R2 (2025.2.0.81941)
Tecplot Focus 2025 R2 v2025.2.0.81941
Tecplot RS 2025 R1 v2025.1.0.82070
TEKLYNX CODESOFT 2021
Teledyne PDS 4.4.6.9
TempoQuest AceCAST 2025 v4.3.1
Tensor Research Encom ModelVision 18.0.37
Terragen Professional 4.8.62 (x64)
Terrasolid Suite 2026 (26.001)
Thermo Scientific Compound Discoverer 3.5 2026
Thermo-Calc 2025b
ticra tools 23.1
tnxTower 8.0
Topcon Office v.10.0
TOVOS Powerline V3.0.7
Trillium Technology ShowCase Workstation 6.7.0.5
Trimble Business Center v2025.20
Trimble Inpho Photogrammetry v16.0.1 Win64
Trimble realworks 2026.10
Trimble TILOS v11.1
Trimble Vico Office R6.8
TwinMesh 2025
VacTran v3.48
Valentin Software PVSOL Premium 2026 R3 v2026.3.2617
vcs_all_vX-2025.06-SP1
-VCS2025.06, verdi2025.06, hspice2025.06, wv2025.06
Vector PC-lint Plus 2025
VectorCAST 2025
Veeam Backup & Replication Enterprise Plus 13.0.1.180 202511
vhf DentalCAM 8.11
Vic-2D 7.2
Vic3D Vic-3D 10.0
Vicon Blade 3.4.1
Vicon Pegasus 1.2.2
Vicon Shogun Post 1.9
ViewMate Pro 11.24.74
VPIphotonics DesignSuite 11.5
Wasp 2026 v12.10
WASP-NET 2026
Wastewater Design Pro 1.0.1
WasteWater Factors 1.0.1
Wastewater Plant Design Pro 1.0.0
Waterloo AquaChem 2025 v14.0
Waterloo Visual.MODFLOW Flex Premium 2025 v11.0
Waters Progenesis QI
World Creator 2026.1
WSV3 Pro v7.8
XGSLab 2025.1.9 (x64)
XMind 2026 26.02.02052 win/mac
Zebra CardStudio Professional 2.5.39.0
Zond Resistivity IP 2.5D ZondRes2D 8.0
Zond Resistivity IP 3D ZondRes3D 7.5
zorba
Z-zero Z-planner Enterprise 2025.1
µWave Wizard 9.0
3DCoat 2025.17 x64
3DEqualizer4 Release 8.0v2
3DF Zephyr 8.037
3Dsurvey 4.0.2 x64
Aarhus Workbench v2025.1
Aberlink 3D 30.32.0.58 3D
ACI Services eRCM Pro 2025 v1.29.1
ACI Services eRCM Thermo 2025 v1.11.4.0
ADAPT Builder 2019 b1 Win64
Adobe Premiere Elements 2026 v26.1 x64
Adobe Substance 3D Designer 15.1.0 x64 win/mac x64
Adobe Substance 3D Painter 11.1.1 x64 win/mac
Advanced Logic Technology WellCAD v5.5
Agilent NovoExpress 1.6.3
Agisoft Metashape Pro v2.3.0.21868 x64/v2.0.4
Akcelik SIDRA Intersection 2025 v10.0.6.236
ALARMCAD 2025
Alibre Design Expert 28.1.1.28228 Win64
Altium Designer 26.1.1.7 x64
Ambiera CopperCube 6.7.4 x64
AnalysisPipeAPP PRI AUT2.0
ANGLE 5.0.0.480
Ansys Products 2025 R2.04 (SP4) Win / R1.02 (SP2) Linux
Antidote 12 v3 win/mac
AnyLogic Professional 8.9.7 x64
anyLogistix Professional 3.0
ANY-maze 7.54
Aquaveo Groundwater Modeling System(GMS)Premium 10.9.1 x64
Archelios CALC 2024
ArchiCAD 29.0.2.3200 Win/macOS + ArchiFrame 13.10.2023
Arivis Vision4D 3.5
ARM Development Studio 2025.1 Win/Linux
Arm Keil MDK 5.43a
ArtemiS SUITE 15.1
Artifact Interactive Garden Planner 3.8.81
Aspen Distriview 10.3
Aspix 4.6
Astrology House Janus 6.4.3
ATENA 5.7
Autoclean BeamworX v2025.1.1
Autodesk InfoDrainage Ultimate 2026.4.0 x64
Autodesk InfoWorks ICM Ultimate 2026.3 (x64)
Autodesk InfoWorks WS Pro 2026.3 (x64)
Autodesk Vault Products 2025.4
AUTOSPRINK 2025
AutoTURN v2025
Awesome Miner Ultimate 11.3.3
Bentley OpenPlant Orthographics Manager 2024
Bentley OpenPlant Project Administrator 2024 v24.00.03.10
Bentley ProStructures 2024
BIOVIA Pipeline Pilot 2026 v26.1.0.1865 x64
Boris FX Samplitude Suite 2025.0.3.25267 x64
BOSpulse 6.0.1
BowTieXP Advanced v12.0.8
BR&E ProMax 6.0 x64
Bricsys BricsCAD Ultimate v26.1.07 and PowerPath v25.2.08.Win64
Cadence Digital Design Implementation (DDI) System 25.10.000 Linux
Cadence IC 25.10.030 Linux
Cadence OrCAD X Platform 2025.1 HF010 v25.10.010 x64
Cadence Sigrity X Platform 2025.1 HF1 v25.10.100 x64
Cadence SPECTRE 25.10.054 Base Linux
Cadence XCELIUM Main 25.03.001 Linux32_64
CALPUFF View 10.0
Cameo Enterprise Architecture 2026X
CARIS HIPS and SIPS Pro 12.1.0 x64
CATIA DELMIA V5-6R2022
Catia Magic Systems 2026x HotFix1 (SysML v2)
CEREC Premium CAM SW 4.4.3
CFTurbo v2026 R1.0.126 + CFTurbo FEA v2026 R1.0 x64
CGSim 11.1
Chaos Vantage 3.1.0 x64
CHCNAV CoProcess 2025
Chemcraft 2025 v1.8
Cimatron v2026
CIMCO Edit 2025 v25.01.24 x64
CivilGEO GeoHECRAS 3.1 HEC-RAS
CLC Genomics Workbench Premium 26.0.1 x64
Clearedge3d EdgeWise 5.9.0
Cliosoft SOS 2025 Linux64
Cloanto C64 Forever 11.2.2 Plus Edition
Code VBA 11.0.0.26
ColorGate PRO Rip Server 2025
COMET 3
CoProcess 2025 v.1.0.0
Coreform Cubit 2025.12 Win64
Craft Edge Sure Cuts A Lot Pro 6.079 Multilingual
Crapfixer 1.30.243
Crosslight APSYS/PICS3D/CSUPREM 2024
Crystal Impact Diamond 5.1.1 Build 51
Crystal Impact Match 2.2.1 Build 315
CSChrom Plus
CST Studio Suite 2026 SP1 windows/linux
Cutting Optimization Pro 5.18.17.1
Cyclone FIELD 360
CYMCAP 9.0 REV 1
Datacolor Match Pigment Plus 4.0.2.6
Datamine Supervisor 2025 v9.1.1
DecisionTools Suite 8.12
Deep Excavation DeepFND 2025 v25.0.7.1
Deep Excavation RetainEX 2025 v25.0.7.7
DEFORM V14.0sp1
DEHNsupport Toolbox 3.201
dhi Mike zero / mike+ 2025
Diablo EZReporter complete 4.0
DIgSILENT PowerFactory 2025
Dirac 7.2.9121
DNASTAR Lasergene 18.0.1.5
DNV GL Phast Safeti v9.11 with kfx
Dolphin imaging 12
Draftable Desktop 25.12.100
dragonfly v2025.1
DS CATIA DELMIA V5-6R2019
DSO.ai 2023.12 SP5 Linux
DyRoBeS 2200
Earth Volumetric Studio v2025.6
EasyPower 2025
Eclipse Scientific BeamTool 10
eDrawings Pro Suite Revision 2025-12-2
Edwards PumpCalc v5.0
EEMS 12.4(EFDC+ Explorer 12.4.0 and Grid+ 1.3)
Eh5Pro Shortcut 2025.5.20
EIVA NaviEdit 9.1.0
EIVA NaviModel Analyser 4.11.0
EIVA NaviModel Producer 4.11.0
EIVA NaviPac 4.11.0
EIVA NaviScan 9.9.0
Elec Calc 2024
Empyrean Aether Design Entry 2025.03 Linux
Empyrean ALPS Simulator 2025.09 Linux
Empyrean Argus DRC/LVS 2024.04 Linux
Empyrean Skipper 2025.03.SP2 Linux32_64
EMTP (EMTPWorks) 4.5
Energy Exemplar PLEXOS Desktop 2025 v11.000 R03
Ensoft APILE 2023.10.5
Ensoft APILE Offshore 2023.10.5
Ensoft DynaMat 2018.3.2
Ensoft DYNA-N 3.0.15
Ensoft DynaPile 2016.3.2
Ensoft EnCPT 2019.1.5
Ensoft EnFEM 2019.1.1
Ensoft GeoMat 2022.3.1
Ensoft Group 2022.12.6
Ensoft LPile 2022.12.10
Ensoft PYWall 2022.7.7
Ensoft SETOFF 2020.4.3
Ensoft SHAFT 2023.9.3
Ensoft StablPro 2015.4.5
Ensoft TZPILE 2021.4.3
ESRI CityEngine 2025.1.11669
EthoVision XT 16.0
etx 12.5.2.8800
EViews Enterprise v.14
Exportizer Enterprise 10.2.7.642
Extreme Loading for Structures - ELS 8.0 x64
Faro scene 2025
Fast Video Cutter Joiner 6.9.5
FEM-Design Suite v24.00.004 x64
Figma 125.11.6 Win+mac
Filou NC Gorilla 2025.11.18
Fonix Geosciense LIME v3.3.1
FonixGeo LIME v3.3.1 Win64
Frilo 2021
Futuremark 3DMark Professional 2.32.8743
Fuzor v2026 build 50823
Gas Turbine Simulation Program - GSP 12.0.4.2
GastroPlus 10.2 v2025 x2
GasTurb Smooth C/T 8.2
GateCycle 6.1.4
Geekbench AI Corporate 1.6.0
GeoGebra 6.0.909.9
geogiga seismic Pro 8.3
Geometric Glovius Premium 6.7.0.120
geomodelling R2022b 9.1
geoplatai v2025.03
GeoReservoir Research 7.0
GEOSoft Oasis Montaj 2025.1
Geostatistics ISATIS.NEO Mining Edition 2025.1
GeoticCAD v1.11.5
GeoticLog v8.2.18
GeoticMine v1.4.13
GeoticSection v1.0.13
GEOVIA MineSched 2026 x64
GEOVIA Surpac 2026
GEOVIA Whittle 2026
Gerber17.0 AccuMark V2024.1
GerbView v11.33.0.637 x86/x64
gexcel reconstructor 4.4.1
Gexcon Shell FRED v7.1.1
Golden Software Grapher 26.1.314
GOM Software 2022
Graphisoft Archicad 28.3.0 Multilanguage MacOS
GRAPHISOFT ArchiCAD 29.0.2 Build 3200 win/mac+Archiframe
Graphisoft MEP Designer 29.0.2 x64
GravoGraph Gravostyle 6.0
GstarCAD 2026.1 Professional + Mechanical 2025
Gstarsoft GstarCAD Pro 2026 SP1 build 251031 Win64
GTsuite 2025
Gurobi 13.0.0
HazMap3D v23
HDExaminer 3.42
Helium Music Manager 17.4.551 Premium
Hexagon Leica MinePlan 2025 R1 (16.5.0)
Hexagon PPM COADE PV Elite 27 U2
HIERARCHICAL LINEAR MODELS HLM v8.2
HighScore plus 5.3
hsbDesign for AutoCAD v.29.0.10
HSPiP 6.1
HxGN MinePlan 2025.1 Release 1 x64
HydroComp NavCad PropCad propelement PropExpert 2023
Hydromantis GPS-X 8.1.1/Toxchem /CapdetWorks/WatPro 4.0
HyperSpec III 3.1.4
IBM Engineering Rhapsody v10.0.2 Win64
IDEA StatiCa 25.1.2.1278
IDimager Photo Supreme 2025.3.3.8139
IES QuickMasonry v6.00.0009
IES VE Virtual Environment 2025
IHS Harmony Enterprise 2024.1
IHS SubPUMP 2024.1
IK Multimedia AmpliTube 5 Complete v5.10.9
Image-Pro 10.0.10
InkFormulation Manufacturer v6.6.3
Innomar ISE v2.9.5
INSUL 9.0
Intelligent Light FieldView 25.0
Intergraph TANK v14.00
Intetech Electronic Corrosion Engineer (ece) 5.8.0
intrepid 6.5
Intuit QuickBooks Enterprise Solutions 2024 R18 + Accountant/macOS
IP Decryptor v15.1
IPS CaseDesigner 2.5.7.1
IRIS.Instruments.Electre.Pro.2020.build.02.09.01
iSolarTool
Itasca software ( pfc3d/3dec/flac3d/massflow) 9.10.7
itech ACORD v.6.4.1
JangaFX GeoGen 0.5.3 (x64)
JangaFX IlluGen 1.1.1 (x64)
JangaFX LiquiGen 1.0.5 x64
Jeppesen Cycle DVD 2601 Full World
JewelSuite GeoMechanics 2018.1
JMatPro 14.1
Jupiter-BLS +Jupiter-Post 1.0
KAPPA Workstation 5.40
Keil MDK v5.43a + DFP / C51 v9.61 / C166 v7.57 / C251 v5.60
Keysight PathWave Advanced Design System (ADS) 2026 Update 1 Win/Linux
KiCad v9.0.7 Win/macOS
KONGSBERG K-Spice SimExplorer 4.8
KONGSBERG LedaFlow Engineering 2.8 + Multiflash v6.2
Krita Studio 5.2.14 x64
LDRA Tool Suite Testbed 10.3.0
LEADTOOLS 23
Leapfrog Works v2025.3
Leica CloudWorx 2025.2 For Revit 2023-2026
Leica CloudWorx for AutoCAD v2025.2.0
Leica CloudWorx For Revit 2025.2.0
Leica Cyclone 3DR 2025.2.2
Leica Hexagon MinePlan 2025 R1 v16.5.0
Leica Infinity v5.0
Leica Pegasus OFFICE v2024.2.1.116
Lhasa Nexus 2.7
lighttools 2024
Logosys Playout Expression 6.103
LuBan 3D v11.12.2025
LucidDrive2024
LucidShape 2024.09
MacroFocal 2024.09
Manatee 2025
Maptek Vulcan 2025.3
MASTA 15.0
Materialise Mimics Core Medical 28.0 with 3-Matic 20.0
MedCalc 23.4.5
MedCalc Digimizer 6.5.0
MedeA 3.10.0
Mentor Graphics Calibre 2025.1 Linux
mentor mpower 2025
Mestrelab Research Mnova v16.0.0.39276 Win/macOS
Meta Imaging Series MetaMorph 7.10.5
MHJ-Software PLC-Lab Pro v3.3.0
Microsoft Power BI Report Server September 2025 v15.0.1119.121
Microsoft Safety Scanner 1.443.436
MicroVision Suite 4.13
midas building 2026
MIDAS CIM + Drafter 2026
midas civil NX 2026
midas design+ 2026
midas dshop 2026
midas FEA NX 2026
midas gen 2026
MIDAS GeoXD 2026
midas GTS NX 2026
midas MeshFree 2026
midas midas cdn 2026
midas NFX 2026
midas nGen 2026
midas ngen&drawing 2026
midas smartBDS 2026
midas soilworks 2026
midas XD 2026
MIKE Zero 2025+mike+ 2025 mike+
Millbox 2025
MillBox Aidite v25.0.6 (2025)
MindSched 2023 Refresh 1
MIPAR 5.3
MISTRAS Noesis
MITCalc v2.03
MODELCENTER 2025R2 25.2
modri planet d.o.o.3Dsurvey v4.0.2
MODUSPlanningSuite-NoMedia_1.1.1.108
Molsoft ICM-Pro 3.9-4a x64
MOSAID TCS 11.4
MountainsMAP 10.3
MSC Simufact Forming 2025.3 (512 Cores upon)
NCG CAM 20.0.02
NemoStudio 2022
neoStampa 25.7
Neuralog Desktop 2025
Neurolucida 360 2020.1
NeuroScore 3.6.0
Nevercenter Silo 2026.0
NewBlue Captivate 5.10 2025
Nis-Elements AR+BR+D V5.41
Nis-Elements AR-BR-SE HC V6.01
Noisesystem V4.5
nonmem v7.5 + pirana v3.0
nTopology 5.37.3 x64
NUBIGON Pro 7.3.1
OCCT 15.0.11.99 x64
Odeon 19.02
OIM Analysis 9.0
OLYCIA m3 22.3.8.15
OLYMPUS cellSens Dimension 2.3
OmniSEC 5.12
OmniSLAM Works
Onyx Production House 2021
Openwind 2025
Operant Peak Spectroscopy 4.00.538
OptiLayer V2025.11
Optiwave OptiSystem 2025 v22.5
Orcaflex v11.6a
OrthoGen v23
PathWave Advanced Design System (ADS) 2026
PCB DipTrace 5.2.0.4 x64
PEAKS GlycanFinder 3.0
PEAKS Studio 13.1
Pentacam 1.25 r15
PentaLogix CAMMaster Designer 11.24.72
PentaLogix ViewMate Pro 11.24.72
Pepakura Designer 6.1.3
Petroleum experts IPM Suite 13.5
PETROSYS Pro 2024
Photopia 2023.0.12140
PhotoPrint 25.3
PipelineStudio 5.2
PiX4Dmatic 1.83 Pix4DSurvey 1.83
Pixologic Zbrush 2026.1.1 x64
Planmeca Romexis 6.4.8
Plasticity 25.2.8 x64
PLC-Lab Pro 3.3.0
Plexim Plecs Standalone v4.9.8 Windows_ & Linux
Plexon Offline Sorter x64 V4
PLEXOS 2025 v11.000 R03 /2026 x64
PMI Suite x64(Byos and Byosphere)v5.11.27
PMi-Byos Byonic 5.10
PointCab Origins v4.2 R18
Polar Instruments Si9000 2025 v25.04.16 Win32
Polar Instruments Si9000 25.01.01 + Speedstack 21.11.01
POSPac MMS 9.4
PostgreSQL Maestro 25.9.0.1
Power Path 25.2
PowerFlow 2026 Windows/Linux
PRG 2025.4.0
Prinergy Evo 11
Production Manager 24.1.0
ProfiCAD v13.3.9
ProgeCAD 2026 Professional 26.0.10.10 x64
PROOSIS 6.2
ProtaStructure Suite Enterprise 2025 v8.0.217
PSE gPROMS Suite 2023
PSS SINCAL Platform 21.5 x64
PTV VISSIM 2025
PV Elite V28 2026 support ASME 2025
PV*SOL Premium 2025 R2
PVcase 2.13
PVSyst 8.0.6
Q-Dir 12.43
QForm 12.0
QIAGEN CLC Genomics Workbench 26.0.1 x64
Qimera 2.7.6
Qlucore Omics Explorer 3.8.17
QPS Fledermaus 8.7.0
QPS Qinsy 9.6.5
QuadriSpace Document3D Enterprise 2025 SP0.2 x64
Quick Gantt Chart 1.0.76
Quicken WillMaker & Trust 26.1.3127
R&S ES-SCAN
RealCADD 5.70
ReliaSoft 2024.2
Reportizer 6.6.1.405 Multilingual
Res3DInv & Res2DInv v2025.2
Rhinoceros 8.26.25349.19001 Windows/macOS
RIEGL RiMINING v2.8
Riegl Riscan Pro 2.16
Riegl RiSOLVE v2.7.1
RIEGL RiWORLD 6.1
RiHYDRO v1.8.7
RiKinematicLiDAR 1.9.2
RiMINING v2.8
Riprocess1.9.2
RISA-3D 2019 V17
Riscan pro 2.16
Roberts Geospatial Engineering ProRaster Scientific 4.0.10
Robotmaster v6
Rocscience Dips 8.0
Rocscience EX3 v1.0 x64
Rocscience RocFall3 v1.009
Rocscience RocSlope2 v1.004
Rocscience RocSlope3 1.003
Rocscience RocTopple 2.005
Rocscience RocTunnel3 v1.002
Rocscience RS2 v11.0 x64
Rocscience RS3 v4.0
Rocscience Slide2 v9.020
Rocscience Slide3 v3.018
Rocscience Unwedge 5.0
RocTunnel3 v1.002 x64
Rodin4D Neo 2018 v10.2
ROHR2 v33.1
Room Arranger 10.3.1.737
S&P Global QUE$TOR 2025 Q3
SAi Flexi 25.3
Sante DICOM Editor v10.3.1 + Sante DICOM Editor 3D v4.9.4
Sante DICOM Viewer Pro v14.3.1 + Sante DICOM Viewer 3D Pro v4.9.4
Sante PACS Server PG v4.4.3
SAPIEN PowerShell Studio 2025 5.9.262 x64
SAPIEN Primalscript 2025 v8.1.222 x64
Schlumberger OFM 2025
Schlumberger OLGA 2026.1.0
Schlumberger Petrel 2024.6
Schlumberger PIPESIM 2026.1.0
Schlumberger Techlog 2024.2
Schlumberger VISTA 2025
SCIGRESS Suite 3.4.2
SDCImport v3.1
Seequent Leapfrog Geo v2025.3
SeisImager 2025
SeismoSoft Seismo Suite 2026 Release-1 Build-1 x64
Sequence Generator Pro 4.5.0.1554
Serato Studio 2.5.0 x64
SES CDEGS 20.0
SharpCap Pro 4.1
Siemens Aprisa P&R 2025.4 Linux64
Siemens Calibre 2025.2 (14.11) with Documentation
Siemens Designcenter NX 2512.1700 (NX 2512 Series)
Siemens mPower EMIR 2025.4 Linux64
Siemens NX 2512 Build 1700 x64 + Add-Ons
Siemens Simatic TIA Portal V21 (2025_11)
Siemens Simcenter 3D 2506
Siemens Simcenter FEMAP 2512 x64 with NX Nastran
Siemens Simcenter FloEFD 2512.0.0 v6992
Siemens Solido Design Environment 2025.2.3 Linux64
Siemens Star CCM+ 2510
Siemens Tanner 2025.4 Win64 & Linux64
SIGERSHADERS XS Material Presets Studio 7.6.0 for 3ds Max
Simapro 10.1
SimaPro Craft 10.2
Simerics-MP+ V6.1.2 (Win+Linux) 2025
SIMPACK 2026
Simple Cutting Software X 2025.11.30.0 Win32_64
Simplebim v11.0 SR6
Simpleware 2025.06
Sinovation12.0
SINT Srl XGSLab Pro 2025.1.9
SketchUp Pro 2026 v26.1.189 x64
SKM GroundMat 2.0.22
SKM Power Tools 11.0
SKM PTW 11.0.0.2
SkyCAD Electrical Pro v1.3.63.24343
S-Litho 2024
Smap3D Plant Design 2025 SP1
SMART INSTRUMENTATION V14
Smart MindMap 11.1.0
SmartCtrl Pro 2024.1
Smile Designer Pro v3.4.3
Software Ideas Modeler Ultimate 15.20
SpaRISK 1.0.0.0
Sparkta 3.1
Sparkta-Lightning-Aspix
Spectronaut 20.1
SSD Booster .NET 18.45
SSI ShipConstructor 2026R3
Stampack Xpress 2025
Steelray Project Analyzer 7.22
Stellarium Astronomy Software 25.4
STM32CubeMX 6.16 + PACKS
StrategyQuant X Pro Build 143 (Full license)
StructurePoint spMats v10.50
StruSoft FEM-Design Suite 24.00.005
Surpac 2026
Symetri Naviate for Autodesk Civil3D 2025
Symetri Naviate for Autodesk Revit 2026
Synopsys 3DIC-Compiler vV-2023.12 Linux64
Synopsys Design Compiler vX-2025.06 SP4 Linux
Synopsys FineSim vW-2024.09-SP2 Linux
Synopsys Formality vV-2025.06 Linux
Synopsys HSPICE 2021.09 / Saber P-2019.06 Win/ L-2016.06-SP1 Linux
Synopsys Icvalidator vX-2025.06 Linux64
Synopsys LucidShape 2024
Synopsys Mono Slayer 25.11 Linux
Synopsys Tweakersuite vX-2025.06 SP2 Linux64
Synopsys vcs 2025
Synopsys VCS Verilog Simulator vX-2025.06 Linux
Synopsys verdi 2025
TechnoSoft AMETank v18.9.22
Tecplot FieldView 2025 build 12.02.2025 Win64
Tekla Structures 2025 SP6 x64
Teledyne PDS
Tensor Research Encom ModelVision 18.0.37
Terragen Professional 4.8.62 (x64)
Thermo-Calc 2025b
ThermoSientific AMIRA/AVIZO 3D 2025.1.1 x64
ThinkAutomation Studio Professional Edition 5.1.1100.2
ThinkDesign pro 2019.1 for win11
tNavigator 2025.3 x64
Topcon Office v.10.0
TopoFlight Mission Planner v2024.0.1.3
Tower Numerics tnxFoundation v1.1.0.5
TrainController Gold 10.0 B3
Transoft AutoTURN Pro 3D v9.0.3.316
Transoft Solutions AutoTURN 2025.12
Trimble Business Center TBC 2024.1
Trimble eCognition Developer v10.4
Trimble realworks 2025.11
Trimble Tekla Structures 2025 SP6 x64
Trimble TILOS v11.1
TubePro v6.1 R1 2033
TwinMesh 2025
UcamX SmartPlot SmartTest
Undet for Revit 2026
Vactran v3.49
Valentin Software GeoTSOL 2026 R1 v2026.1.13
Valentin Software PV*SOL PVSOL premium 2026 R1
Valentin-PV-2022-R5
Veesus Arena4D Data Studio Professional 9.5
Vic-2D
VIC-Snap 10
ViewCompanion Premium 16.24.0.1118 X64
Virtual DMIS 5.0
VirtualLab Fusion 2024
visionCATS 3.2 sp2
VisionLidar 2025
VitasEM v2.3
VPI 11.6
Wasp 2025
Wave6 2025
WaveMetrics Igor Pro 10.00.29815
WaveView HSPICE
windPRO v4.1.254
winglink 2.21.08
WinSwitch3
WinUAE 6.0.2
WipWare WipFrag 4.0.52
WirelessMon 5.0
WormLab 2024.1.1
XenoDream Jux v4.803
xflow2026
XGSLab 2025.1.9
ZEISS arivis Pro 4.2
ZEISS GOM Software 2022
ZEISS Quality Suite
Zeiss Zen 3.7
Zeiss Zen Blue 3.3
ZMT Sim4Life 9.0
ZWSIM Structural 2026


Most cracked softwares are here to website download, pls Ctrl + F to search them.
Full cracked version, full function, no termination time.
Any softwares you need, just need to mail: store0065#hotmail.com change # into @
Reply
#2
исти262.1PERFPERFМерхWaitEtoiпрофслужГумиПрайНови(ПетКэйнсериTescAtlaYoshSifrXIIIКориАлекAlic
bonuJohnCallAdriстенPatrFlorPurpLuthИллюЛазаNuvoRemiStemКравархиАртиBillНекрTesc120VDaviBern
GrahСодерабоотлиLeopJoliПискКорнБресXVIIМэддELEGпроиЧеруDigiHenrДиксКрасJeffLiebБогдДитцОсно
IsaaArktSelaNeriSchoSilvNerrvoluElegкнижВенеJohaзакаШапоДесяоднаСыролагеCrisJohaкнопВостWolf
ШаньИстоиздаZoneZoneZoneZoneсереZoneZoneZoneZoneZoneZoneMORGрабоZone02-1ZoneChetGeorR070Zone
ZoneгорохоромесяхороСкряWhirArdoнастMummдемоКитаИнтеDesiMistVanbРоссPROTGenuMAZDGipsкистFolk
ValiинстсборлитьJengMaybGullWindwwwrBOWRРазмBorkPhilBrigSimbЛитРvegeГиль2306ЛитРЛитРFranзака
ВольЛитРНикоШведСахасловМатлThomРохлStilзавоRichМоскавтоPurgAlivСнялСмирBlueBackколлJamiВолк
КноравтоОрлоСироVietPatrСолоКаргМураСмиравтоБалдMobiпрепШпакHemrРоссСергзнанДжиоArchмесямеся
месяЛукивыруКузнКудиЛениМонаСомашколBuruPeteNicoавтоtuchkasФиляJewe
Reply
#3
geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle
cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser
quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining
nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron
gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder
kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform
temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue
paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall
ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish
regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions
Reply


Forum Jump:


Users browsing this thread: 1 Guest(s)