![]() |
|
Faro As-Built v2025.0 for AutoCAD v2026 - Printable Version +- Grand Theft Auto Forum (https://gta.how) +-- Forum: Grand Theft Auto Games (https://gta.how/forum-1.html) +--- Forum: GTA 6 News & Rumors (https://gta.how/forum-2.html) +--- Thread: Faro As-Built v2025.0 for AutoCAD v2026 (/thread-81895.html) |
Faro As-Built v2025.0 for AutoCAD v2026 - Romdastt - 02-25-2026 Anything you need, just email to: crdlink#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: crdlink#hotmail.com change # into @ 3DCoat 2025.10 x64 3DF Zephyr 8.017 3diemme Realguide 5.4.2 + Library 4DDiG DLL Fixer 1.0.7.3 Multilingual Adobe Substance 3D Painter 11.0.3 x64 Adobe Substance 3D Sampler v5.1.0 x64 Adobe Substance 3D Stager 3.1.4 Agisoft Metashape Pro v2.2.2.21069 AISC Design Guide 6 Alfa eBooks Manager Pro/Web 9.3.5.1 AlfaOBD 2.5.7 Altair Twin Activate 2025.0 Altium Designer Lifecycle 1.0.0 build 6 AMIQ DVT Eclipise IDE 2025 v25.2.14 Analyst 1.7.4 ANSYS Products 2025 R2 win/Linux AnyBody Modeling System 8.0 AnyLogic Professional 8.9.5 anyLogistix Professional 3.4.0 ANY-maze 14.9 AnyTime Organizer Deluxe 16.2.2 ArchForm ArchiCAD 28.3.0.6000 Win/macOS + ArchiFrame 13.10.2023 Arm Keil MDK 5.43 ASDIP Concrete 6.1.0.1 ASDIP Foundation 5.6.0.6 ASDIP Retain 6.2.1.6 ASDIP Steel 6.5.2.1 ASDIP Structural Concrete v6.1.0.1 ASDIP Structural Suite 2025 AspenTech aspenONE Suite 2025 v15.0 Autodesk AutoCAD 2026.1 x64 Autodesk 2026.2 x64 AVEVA Point Cloud Manager v23.1.0.0 Awesome Miner Ultimate 11.2.2 Baker Hughes Autograph PC 12.2 BASCOM AVR 2.0.8.7 BeamworX Autoclean 2021.3.1.0 Bernese 5.4 BioPharma Finder_5.2 Bladed V4.8 BlueSkyPlan v5.0.8.2 BMI BlastPlan 3 v2.99.4 BowTieXP Advanced 12.0.7 CAD SpinFire Premium 2025.2.0 Cadence EMX v25.10.000 Linux Cadence EXT 19.10.000 Linux Cadence gpdk180 v3.3 Linux Cadence JASPER Apps 2024 (24.12.000) Cadence JASPER v24.03.000 Linux Cadence OrCAD X Design Platform 2024 (24.10.006) Cadence SPB OrCAD X/Allegro X 2024 v24.10.005 x64 Cadence SYSVIP 01.25.008 Linux Cadence VIPCAT 11.30.106 Linux CADware Engineering 3D Space ProfLT v17.2.0.3 Cadwork Twinview 19.0.7.0 CADWork v18.0.290 suite (wood/engineer 2D, 3D, 2DR, 2DV) CAESES 5.2.6 CalepiLight Pro 1.22a Calsep PVTSIM Nova 7.0.16122 x64 CAM-Tool CAMTool 15.1 CAMWorks 2025 SP3 x64 CAMWorks ShopFloor 2025 SP3 x64 Canute FHCPro v1.8.6 Carlson SurveyGNSS 2025 v3.0.6.0 Centrilift Autograph PC 12.2 CEREC SW v5.2 Certainty3D TopoDOT 2025.1.4.2 CGTech VERICUT 9.6 Chessbase 18.14 Chief Architect Premier X17 v27.1.0.54 CHITUBOX Dental v1.2.0 Cimatron 2025 SP4 CIMsystem SUM3D Dental CLC Genomics Workbench Premium 25.0.3 Win/Linux Clearedge3d EdgeWise 5.8.5 Cloanto C64 Forever 11.1.1 Plus Edition COAA PlanePlotter 6.7.2.4 ColorGATE 2025 PRODUCTIONSERVER 2025 Compound Discoverer3.4 Converge Studio 2025 v5.0 Win/Linux Coreform Cubit (csimsoft Trelis) 2025.8.0 CorelDRAW Technical Suite 2025 v26.2.0.170 x64 CrystalMaker 11.5.1.300 x64 + SingleCrystal 5.2.0.300 Cutting Optimization Pro v5.18.13.1 cvision bulder 3.3 Cyberlink PerfectCam Premium 2.3.7732.0 CYMCAP 9.0 CYPE 2025.d Datamine Discover 2024 Build 23.0.375 Datamine PA Explorer 2025 v20.0.39 Datamine PixPro 1.7.13 Datamine RM 2.2 Datamine Studio OP (64-bit) 3.0.313 Dental Wings DWOS 2023.2 v16.2.3 devDept Eyeshot 2023.3.725.2 DHI FEFLOW 2025 v10.0.6 DNV Nauticus Hull 2025 v20.36 Dnv nauticus hull rule check 2022 DNV Phast&Safeti 2025 v9.1 DNV Sesam Package 2025 DNV Sesam Pipelines 2025 DNV SIMA 5.0 Draftable Desktop 25.8.0 DTG RIP Ver10.3 Easy Gamer Utility PRO 1.3.83 ECam Pro 5.0.409 EFDC+ Explorer 12.3.0 and Grid+ 1.2 EFICAD SWOOD 2024 SP4.0 EMPIRE XPU 9.1.1 EMX 25.10 Enscape v4.10.0.464 x64 EnviroSim BioWin 2025 v6.4.0 ESI BM-STAMP 2025.0 ESI PAM-STAMP 2025.0 ESRI ArcGIS Pro v3.5.3 x64 + Help + Data Interoperability + Database Files + Data & Content Estlcam 12.145 Faro scene 2025.1 Fast Video Cutter Joiner 6.9.0 FIFTY2 PeronLab 6.2.8 Figma 125.1.5 Win+mac fine GEO5 2024 Pro English Flite Software Piping Systems Fluid Flow v3.54 Flow3d 2024 Flownex Simulation Environment 2025 R2 v9.0.1.5946 x64 Fort Firewall 3.19.4 Fracpro 2024 v10.13.22 FreeCAD 1.0.2 FunctionBay RecurDyn 2024 SP2 Futuremark 3DMark Professional 2.32.8426 GAGEtrak 8.7.0 GEO5 Suite 2025 Professional Package GeoGebra 6.0.898.1 Geometric Glovius Premium 6.6.40.0 Geometric NestingWorks 2025 SP1 for SolidWorks 2024/2026 x64 Geopainting GPSMapEdit v2.1.78.18 FIX1 Geoplat SG 2025 v25.3 geoplatai v2025.03 Geoscience ANALYST v4.6.1 GEOVIA MineSched v2025 GEOVIA Surpac 2025 Refresh 1 (x64) GerbView v11.16.0.612 GMG ColorProof 5.17 GMG ColorServer 5.6 GMG OpenColor 3.3 GMG ProofControl 2.6 GoFarm v1.00 Build 10.06.2025 GOHFER 9.6 GrafCet Studio Pro 2.5.0.7 Graitec Advance PowerPack 2026 For Autodesk Revit Win64 Graitec PowerPack 2026 For Advance Steel/Revit/Inventor/ Graphisoft ArchiCAD v28.3.0 Build 6000 x64 GraphPad Prism 10.6.0.890 Win/macOS GravoGraph Gravostyle 6.0 GstarCAD 2026 Professional Mechanical 2025 Build 20241112 gt-suite 2025 Helium Music Manager 17.4.495 Premium Hexagon AlphaCAM 2025.2 Hexagon CABINET VISION 2025.2 Hexagon DESIGNER 2025.2 Hexagon NCSIMUL 2025.3 Hexagon PC-DMIS 2023.2 Build 139 (x64) Hexagon WORKNC 2025.2 HIERARCHICAL LINEAR MODELS (HLM v8.2) Home Design 3D 5.1.727 Hydrology Studio Suite 2025 Hypack 2025 Hyperdent 10.0.2 IDimager Photo Supreme 2025.3.3.8073 IHS Kingdom Suite 2025 v19.0 HF3 IHS SubPUMP 2023 v1.1 imobie DroidKit 2.3.7.20250827 ImplaStation 5.3 InventorCAM 2024 SP3 HF3 for Autodesk Inventor 2018-2025 x64 Itasca PFC Suite 9.10 x64 Jeppesen Cycle DVD 2518 Full World JMatPro 13.0 JRiver Media Center 34.0.64 x64 KiCad v9.0.4 Win/macOS Lakes Environmental ARTM View 1.4.2 Lakes Environmental AUSTAL View 8.6.0 Landmark EDT 5000 v18.0 Leapfrog geo 2025 Leica CloudWorx for AutoCAD v2025.1.0 Leica CloudWorx for Revit v2025.1.0 Leica Cyclone Register 360 Plus BLK edition v2025 Let It Be Light 2.0.5 LightBurn 2.0.02 lighttools v2025 LipidSearch 5.1 Lumina Analytica Optimizer 6.5.11.266 x64 Luxion Keyshot Studio Enteprise 2025.2.1 v14.1.1.5 x64 Marmoset Toolbag 5.02.5021 x64 + Library Marshall Day Acoustics INSUL v10.0.6 x64 Mass Frontier 8.1 Materialise Magics 29.0.0.530 + MatConvert 11.2 x64 (x64) Materialise Magics 29.01 with Ansys Simulation 4.2.0 MATLAB R2025a Win/Linux/macOS MaxCut Business Edition 2.9.5.4 Mecway 28.0 x64 MedCalc 23.3.5 Metalix cncKad + AutoNEST 17.3.554 MHJ-Software GrafCet Studio Pro 2.5.0.7 MHJ-Software PLC-Lab Pro 3.2.0 Microsoft PIX 2507.11 (x64) Microsoft Safety Scanner 1.435.383 MicroStation CONNECT Edition 2025 (25.00.00.119) MODALIZER Plus 6.1.0 Moldex3D 2025 MSC Easy5 2025.1 Multiquant 3.0.3 Native Instruments Maschine v3.3.0 +Mac3.3.1 NCSS PASS Professional 2025 v25.0.2 Nemetschek FRILO 2025.2 Nemetschek SCIA Engineer 2025 neoStampa 25.6 NetSarang Xmanager Power Suite 8.0014 NeuroExplorer 5.035 NeuroScore 3.6.0 NI LabVIEW 2025 Q3 Patch 2 v25.5.2.49153 + Toolkits and Modules NI VeriStand 2025 Q3 with Drivers NovAtel Inertial Explorer v10.0 GNSS/INS nTop nTopology 5.29.2 Win64 OCCT 14.2.6.99 x64 OkMap Desktop 19.0.0 x64 OLYMPUS cellSens Dimension 2.3.18987 OnDemand3DApp 2024 OnDemand3DCommunicator 2024 OnDemand3DDental 2024 OnDemand3DServer 2024 OpenRail Designer 2024 (24.00.02.25) OpenRoads Designer 2024 (24.00.02.25) OpenSite Designer 2024 (24.00.02.25) Openwind 2025 O-Pitblast v1.8.3 O-PitSurface v1.8.3 optisystem v22.1 Optum G2 2021 v2.2.20 & Optum G3 2021 v2.1.6 OREPro 3D v.3.4.1 Orica SHOTPlus v6.24.1 OrthoRx Release v6.2 PathWave Advanced Design System (ADS) 2026 PC-PUMP 3.7.3 PEAKS Studio 13.0 Peters Research Elevate v9.2 Petrosys PRO 2024.2.3 PhraseExpander Professional 5.9.8.0 PIC C Compiler (CCS PCWHD) 5.119 Plexon Offline Sorter V4 PLEXOS 11.0 PMI Suite x64(Byos and Byosphere)v5.10.62 PointCab Origins v4.2 R18 POSPac mms 9.4 Preps 10.0 PressSIGN 12 prinergy 11 ProfiCAD v13.1.7 prolink III v4.8 Prometech ParticleWorks 8.0 (x64) Promob Plus Enterprise 2023 v5.60.21.3 Proteome Discoverer 3.2 Proteus Professional 9.0 SP2 psse 36.2 PTC Creo v12.4.1.0 PVTsim Nova 7.0.16122 x64 Qbitec v1.3.2 for Autodesk Revit Q-Dir 12.33 Qlucore Omics Explorer 3.8.17 QPS Qimera v2.7.4 Quad Remesher 1.3 QUAD-4 QUAD4M R2GATE 2023 RAM Concept 2024 (24.00.02.66) RAM SBeam 2024 (24.00.00.334) ResX 2024 for Petrel 2023 Revive Faces 2.0.5 Rhinoceros 8.22.25217.12451 Richpeace Garment CAD Enterprise v6.3.1 RISA-3D 19.01 Riscan Pro 2.16 Rizom-Lab RizomUV Real & Virtual Space 2025.0.67 x64 Rocscience EX3 v1.0 x64 Rocscience RocFall3 v1.009 Rocscience RocTopple 2.005 x64 Rocscience RocTunnel3 v1.0 x64 Room Arranger 10.2.0.732 RushForth Tools for Revit 2026 Sante DICOM Viewer Pro v14.2.5 + Sante DICOM Viewer 3D Pro v4.9.4 SAPIEN PowerShell Studio 2025 5.9.259 x64 Scale Photo Up 2.0.5 Schlumberger Drilling Office DOX 2.10 Schlumberger PetroMod 2025 Schlumberger Techlog 2024.2 + Plugins Schrodinger Suites 2025-3 Windows/Linux Scientific Toolworks Understand 7.1 Build 1232 Win64 Sciex OS 3.0 Seequent Leapfrog Geo 2025.1.1 Sentieon Genomics 202503.01 Linux SETCAD 2D 3.5.0.99 x64 SideFX Houdini INDIE 21.0.440 Win x64 Siemens FiberSIM v17.5.0 Siemens NX 2506 Build 4001 Siemens SIMOTION SCOUT V5.7 SP1 Siemens Solid Edge 2025.2410+MP08 Siemens Xpedition Enterprise 2409 sigmanest 2025.2 Sim4Life V9.0 Simio RPS Edition 2024 v18.269 SKM Power Tools 11.0.0.2 with Complete Features Skyline TerraExplorer Pro 8.1.0 Build 41223 Skyline.SkylineGlobe.Server.v8.2.1 SLB Symmetry 2025.2 Smap3D Plant Design v2025 SMT MASTA 14 Software Ideas Modeler Ultimate 15.01 SolidCAM 2025 SP2 HF1 x64 for SOLIDWORKS SolidWorks 2025 SP3.0 Full Premium x64 Sonnet Suite v19.52 spatialanalyzer spatial analyzer 2025 SpatialBox 1.2.2 Spectronaut_20 Sprutcam MachineMaker v15 SSD Booster .NET 18.24 SSI ShipConstructor Suite Ultimate 2023 Starrag RCS 7.50 Starry Night Pro Plus 8.1.1.2094 Stat-Ease 360 v25.0.1 Steelray Project Analyzer 7.20.4 Stimpro 2024 v10.13.23 STK 13.0.0 and ODTK 13.0.0 SweetScape 010 Editor 16.0.1 synopsys 2025.06-sp1 Synopsys CODEV 2025.03 Synopsys Euclide 2024.09 Linux Synopsys Finesim vW-2024.09 Linux64 Synopsys Lib Compiler vW-2024.09 SP1 Linux64 Synopsys LightTools 2025.03 Synopsys LucidShape 2024.09 Synopsys Primesim XA vW-2024.09 SP1 Linux64 Synopsys RSoft Photonic Device Tools 2024.09 SP2 Win/Linux64 Synopsys Sentaurus v2024.3 Synopsys Simpleware 2025.06 Win/Linux64 Synopsys S-Litho.2024.06 Synopsys Synplify FPGA 2025.06 Win/Linux64 Synopsys VCS Gnu vW-2024.09 Linux64 Synopsys WaveView adv vW-2024.09 SP1 Synopsys XA vW-2024.09 SP1 Linux64 Tajima DG/ML by Pulse 17 Tajima X2 12.0.1.3324 Tecgraf GoFarm v1 build 10.06.2025 Techlog 2024.6 Tecplot 360 EX + Chorus 2025 R1 2025.1.0.72401 x64 Tekla Structures 2025 SP4 + Environments Telerik Collection NuGet Packages 2025 Q2 tesseral pro v5.3.0 x64 Thermo Scientific Compound Discoverer 3.4 2025 TraceFinder 5.1 Trimble Photogrammetry 2025 v15.1.1 Trimble RealWorks 2025.1 Trimble Tekla Structures 2025 SP4 x64 Trimble UASMaster 2025 v15.1.1 Trimble RealWorks 2025.11.5984.0 TS85 4.8 Undet for Revit v.26.1.0.2992 Virtual Reality Geological Studio 3.2 Build 31 visualizer-2025.2 Linux VPIphotonics Design Suite 2025 v11.6 V-Ray Next 7.x for 3ds Max, Maya, Revit & Other 2025-8 WinGlink 2.301 WinMerge 2.16.50.2 WinUAE 6.0.1 Wolfram Mathematica 14.3 Wolfram System Modeler v14.3.0 x64 CNCKAD V23.3293 petrel 2024.6 Etap 24.0.3 Cyme 9.5 CDEGS 20 Xgslab 24 Optiwave OptiSystem 2025 v22.1 TASKING_TriCore-VX_v6.2r2 Faro As-Built v2025.0 for AutoCAD v2026 ExtendSim 10.0.7 3DVista Virtual Tour Suite 2025 PHA-Pro 8.21 Synopsys Design Compiler (Synthesis) 2024.09 Linux64 auton mold cam v12 AVEVA E3D Design (Everything3D) 2024 v3.1.8 XGSLab v2024 BlueSkyPlan 5.0.17 fuzor 2025 Novlum uniTank v3.2.11 API 650, API 653, API MPMS 2.2 Exata v8.3 Qlucore Omics Explorer 3.8.17 Genesis 2000 v13.0.1 Frontline 3D Rocscience EX3 v1.0 x64 3D Space TopoLT v17.2.0.11 + ProfLT/TransLT 3DCoat 2024.32 x64 3DEC v7.00.157 3DQuickForm 3.4.1 for SolidWorks 2009-2022 x64 3DVista Virtual Tour Suite 2025 Adobe Substance 3D Designer 15.0.1 x64 win/mac x64 Adobe Substance 3D Modeler v1.22.3 (x64) AFT Fathom 2025 v14.0.1100 Agisoft Metashape Pro v2.2.2.20870 x64/v2.0.4 + v1.6.0 x86 AIST Software PeakLab v1.08.01 Alfa eBooks Manager Pro/Web 9.3.3.1 Alibre Design Expert 28.1.1.28227 x64 ANSYS EMA3D Cable/Charge 2025 R2 x64 ANSYS Forming 2025 R2 x64 ANSYS Motor-CAD v2025 R2.1 ANSYS Products 2025 R2 x64 ANSYS SCADE 2025 R2 x64 ANSYS SpaceClaim 2025 R2 Ansys STK 12.10.0 + ODTK 7.10.0AGI anyLogistix 3.3.2 ANY-maze V7.49 AnyTime Organizer Deluxe 16.2.1 AP-TIME Aquaveo Groundwater Modeling System(GMS)Premium 10.8.10 x64 ArchiCAD 28.2.2.5200 Win/macOS + ArchiFrame 13.10.2023 Arena Simulation Professional 16.1 ARES Commander v2026.1 SP1 Build 26.1.1.2171 x64 ARES Electrical 2026.1 Build 26.1.1.2172 x64 Arivis Vision4D 3.5 Artifact Interactive Garden Planner 3.8.76 ASAP 2021 ASDIP Structural Concrete v6.0.0.2 Atlassian Suite 2021 AutographPC64 12.2 Autolign auton mold cam v12 AUTOPIPE Vessels V45 2024 AutoPlotter Pro 1.0.0 AutoRebar 2026 v3.3.2 for Autodesk AutoCAD 2015-2026 AVEVA E3D Design (Everything3D) 2024 v3.1.8 Awesome Miner Ultimate 11.1.8 Baker Hughes Autograph PC 12.2 Bentley Adina Ultimate 2025 CONNECT Edition v25.00.00.634 Win64 Bentley Maxsurf 2025 v25.00.00.280 x64 Bentley MicroStation 2025 v25.00.00 Bentley OpenPlant 2024 Bentley OpenPlant CONNECT Edition 10.09.00.74 / Isometrics Manager 24.00.02.13 x64 Bentley OpenPlant Modeler 24.00.02.28 x64 Bentley OpenPlant PID 24.00.02.16 x64 Bentley Raceway and Cable Managment 2024 v24.00.02.19 Bentley RAM Connection 2025 Patch 1 v25.00.01.10 x64 Bentley RAM Elements 2025 Patch 1 v25.00.01.11 x64 Bentley RAM SBeam 24.00.00.334 x64 Bentley RAM Structural System 2025 v25.00.00.187 x64 Bentley SACS 2025 v25.00.00.136 x64 Bentley STAAD Foundation Advanced 2025 v25.00.01.287 x64 Bentley STAAD Pro Advanced 2025 25.00.02.539 Bentley SYNCHRO 4D Pro 2025 v6.5.6.30 x64 BioSolveIT SeeSAR 14.1.2 Full Version BioWin 6.33 Bladed 4.8 BlueSkyPlan 5.0.17 BowTieXP Advanced v12.0.7 BricsCAD Ultimate 25.2.07.1 Win/Mac/Linux + Communicator Bureau Veritas HydroStar v8.3.3 Win64 Bureau Veritas VeriSTAR Homer v2.2.8 Win64 BUW EMX 16 (Expert Moldbase Extentions) 16.0.6.1 for Creo 10.0.x Cadence FINE MARINE 12.1 Cadence IC Design Virtuoso 25.1 Linux 5DVD Cadence MODUS 23.12.000 Linux 3DVD Cadence PVS 22.20.000 CALPUFF View 10.0 Calsep PVTsim Nova CCS 7.0.16118 CARIS HIPS and SIPS Professional 12.1.0 Carlson Survey Embedded 2016 Carrier HAP (Hourly Analysis Program) 6.2 Catia Magicdraw Cameo 2024x Refresh2 HF1 cellSens CEREC SW 5.2 Certainty3D TopoDOT 2025.1.4.2 For Microstation Cervenka Consulting ATENA 5.7 CFTurbo v2025 R2.0.117 + CFTurbo FEA v2025 R2.0 x64 cgs oris 4.4 Chaos Vantage 2.8.1 Chief Architect Premier X17 v27.1.0.54 x64 win/mac Cimatron 2025 SP3 P1 CLC Genomics Workbench Premium 25.0.2 x64 Clearedge3d EdgeWise 5.8.5 Cloanto Amiga Forever Plus Edition 11.0.22 Cloanto C64 Forever 11.0.22 Plus Edition CMG v2025.20 CNCKAD V23.3239 Code VBA 11.0.0.22 Coder MikroMap 5.85 Polish Win32 codev v2025.3 COLOR TUNER 4.4 ColorGATE PRODUCTIONSERVER 2025 Complete Anatomy 2025 Converge Studio 4.1.2 CoPre 2.9.1 CoProcess 2.7.2 CorelDRAW Technical Suite 2025 v26.2.0.16 x64 COSMOlogic COSMOthermX 19.0.4 & TmoleX 4.5.3 x64 Coventor SEMulator3D 11.2 Crapfixer 1.11.71 CSI ETABS Ultimate 22.7.0.4095 x64 CSI SAFE 22.7.0.3220 x64 CSoft WiseImage Pro 23.0.1792.1903 x86/x64 + 22 for AutoCAD Cutting Optimization Pro v5.18.12.10 CYMCAP 9.0 CYPE 2025.d Dassault Systemes DraftSight Enterprise Plus 2025 SP3 x64 Datacor AFT Fathom 2025 v14.0.1100 DATAKIT CrossManager 2025.3 Build 2025.07.02 Datamine RM 2.2 Datamine Studio EM 3.0.58 Datamine Studio RM 2.2.304 Deltek Acumen 8.8 Dental Wings DWOS 2021 dentone 2024(onedesign) 1.6.5.2 Design-Expert 13.0.5.0 x64 desktop2024r2 Deswik Suite v.2025.1.2081 Deswik.CAD 2025.1 DHDAS 6.22 DHI FEFLOW 2025 v10.0 DHI MIKE ZERO 2024 Diamond Cut Forensics Audio Laboratory v11.08 DigBehv DigitalOfficePro HTML5Point 4.1.70 DLUBAL RFEM 6.04.0011/5.38.01 DNV Nauticus Machinery 2025 v14.9.0 DNV Sima 2025 v5.0 Dolphin imaging 12 Draftable Desktop 25.6.200 Dragonfly 2024.1 DS DraftSight Enterprise Plus 2025 SP3 x64 DS SolidWorks 2025 SP3.0 x64 Earth 3D Suite 2025.415.980.0 Easy Gamer Utility PRO 1.3.78 EasyPower Advanced 2024 ECam PRO 5.0.406.0 Eclipse 2024.1 EEMS 12.3 EFICAD SWOOD 2024 SP4.0 for SolidWorks x64 EIVA NaviScan 9.9.0 Electronic Corrosion Engineer Emeraude 5.5006 EMPIRE XPU 9.1.0 EMTP-RV 4.3.1 EMX 25.10 Envirosim Biowin 2025 6.3.3 Eriksson Technologies Culvert v6.3.6.4 Eriksson Technologies PSBeam 4.82 ESI BM-STAMP 2025.0 ESI PAM-STAMP 2025.0 ESKO ArtiosCAD25.03 Build 3785 Win64 Esko Artpro & Powerlayout 16.0.1 MacOSX ESKO ArtPro 20 MacOSX ESKO ArtPro 20.0 Windows ESKO ArtPro+ v22.07.29 MacOS ESKO ArtPro+ v25.07 Win64 Estlcam 12.142 EthoVision XT 18 Euclide 2024.09 Eclipse 4.27.Linux32_64 exata Exata 8.3 Exata v8.3 EXCESS-HYBRID II V9.1.2.2 ExtendSim 10.0.7 FARO As-Built 2025.0_for AutoCAD 2026 FARO BuildIT v.2024.0 FARO SCENE 2025.1.0 Fast Video Cutter Joiner 6.8.6 Multilingual FastFlix 5.12.4 Flaresim 2024.3 Flexi v22(PhotoPrint v22) FLOW3D HYDRO 2023R2 +FLOW3D POST 2023R2 FLOW-3D v11.2 Fort Firewall 3.18.10 Fracpro 2023 V10.13.16.0 Frontline Analytic Solver For Excel 2025Q2 Frontline Excel Solver 2025 Fuzor2026 FX Math Tools v25.07.29 with MultiDocs x64 FX Science Tools v25.07.29 x64 GastroPlus v9.5 gasturb 14 GateCycle 6.1 GeoGebra 6.0.894.2 Geogiga Seismic Pro Geometric Glovius Pro v6.6.10.0 x64 Geoplat AI 24.03 GEO-SLOPE GeoStudio 2025.1.0 x64 geosoft oasis montaj v2024.1 GEOVIA MineSched 2024 GEOVIA Surpac 2025 GerbView 11.15.0.610 + Portable gexcel reconstructor 4.4.1 Gexcon EFFECTS 12 Gohfer3d v9.5.0.6 GOM Software2022 GPR-SLICE V7.0 Graitec Structural Analysis and Project Management 2026.0 Graitec Tricalc 2026 v18.0.00 x64 GRAMS Suite v9.2 GRAPHISOFT ArchiCAD 29.0.0 Build 2001 win/mac+Archiframe gt-suite 2025 Halliburton Landmark Engineer's Desktop 2025 v18.0.00 Win64 Hampson Russell 2024 Harmony Enterprise2023 HasenbeinPlus 2025 hbm ncode v2023 Helium Music Manager 17.4.468 Premium Hexagon ALPHACAM 2025.1 Hexagon CABINET VISION 2025.1 Hexagon RADAN 2025.1 Hexagon TANK 14 hierarchical linear models HLM v8.2 HighScore plus 5.3 HSPiP 6.1.02 HVAC Solution Professional 2021.6.11 HxGN MinePlan 2024.2 HydroCAD Software Solutions HydroCAD v10.20-7a HydroComp PropCad Premium 2023 HydroComp PropElements 2023 HydroComp PropExpert 2023.1 Hydrology Studio Suite 2025 HydroSurvey 7.0.3 hyperDENT hyperdent-compact V9.4.3 IAR Embedded Workbench for ARM 9.70.1.13552 IDimager Photo Supreme 2025.3.0.7929 IDS GRED HD1.09 IES Virtual Environment IESVE 2023 IHS Harmony 2024.1 IHS Kingdom Suite 2025 smt IHS Questor 2024 Q1 IHS SMT Kingdom Suite 2025 IHS SubPUMP 2023 v1.1 image pro10 Immersive Display PRO 6.2.2 imobie DroidKit 2.3.6.20250801 Infycons AutoPlotter Pro 10.18 InnomarISE SES2000 ISE 2.9.5 Innovyze InfoWorks ICM 2021.1 Intel OneApi Developer Tools 2025.2.0 Win win/linux IntelliTrax 2.1.1.3 Interactive Petrophysics IP 2025 INTERSECT 2024.1 InventorCAM 2025 SP2 HF1 for Autodesk Inventor 2018-2025 x64 Invivo 7 IQSTAR 1.2 x64 Irazu 6.2 iTwin Capture Modeler 2024 Update 1.8 (24.1.8.680) JangaFX GeoGen 0.5.0 (x64) JangaFX IlluGen 1.0.0 (x64) Jason2024.2 +Powerlog2024.2+HampsonRussell2024.2 JewelSuite GeoMechanics 2022.2 JMatPro 13.0 JRiver Media Center 34.0.51 x64 Kameleon FireEx KFX 4.0.7 Kappa Workstation 5.6003 KeyShot Studio VR 2025.2 v14.1(x64) Keysight 89600 VSA 2024 Keysight ADS 2026 Win64 & Linux64 Keysight PathWave Advanced Design System (ADS) 2026 Win/Linux Keysight PathWave Vector Signal Analysis (89600 VSA) 2024U2 Keysight Physical Layer Test System (PLTS) 2025U1 KiCad v9.0.3 Win/macOS KISSsoft 2025 SP1 25.0.0.1 x64 KONGSBERG K-Spice 4.8 Kongsberg LedaFlow Engineering v2.8 Krita Studio 5.2.11 (x64) Lakes Environmental CALPUFF View 10.0 LDRA Tool Suite Testbed 10.3 LeapFrog Works 2025.1 L-Edit 2023.2 Update 3 Leica CloudWorx 2025.1 For AutoCAD 2023-2026 Leica CloudWorx 2025.1 for Bentley 2023-2025 Leica CloudWorx 2025.1 For Revit 2023-2026 Leica Cyclone 3DR 2025.1 Let It Be Light 2.0.2 Lidar DP 2.0 LightBurn v2.0.02 x64 lighttools v2025.3 LipidSearch 5.1 Living Image 4.5 LoliTrack v5 Lucidshape 2024.09 Luxion Keyshot Studio Enteprise 2025.2.0 v14.1.0.154 x64 Maestro 3D V6.0 Dental Studio MagicDraw 2024x Refresh2 Cameo Systems Modeler 2024 Maplesoft Maple Flow 2025.1 x64 MASTA 15 Mastercam 2026 v28.0.7534 x64 MatchID-2D/3D v2025 Materialise Magics 29.0.0.530 + MatConvert 11.2 x64 (x64) MathWorks MATLAB R2025a Update 1 WIN+MAC+Linux MecaStack v5630 MedCalc 23.3.1 Mentor onespin 2025 MEscopeVES + MEscopeNXT 23.0 Meta Imaging Series MetaMorph 7.10.5 Meyer2025 MFrac Suite MGT6 Microsoft Safety Scanner 1.431.395 Milestone XProtect Essential+ 2023 R3 millbox 2024 Minitab 22.3.1 x64 + Workspace 1.5.1 MITCalc v2.03 ModelVision 18.0.37 MSC Simufact Welding 2024.2 x64 MTSOFT2D 2.3 nanoCAD Suite 2025 v25.0 x64 Native Instruments Maschine v3.3.0 +Mac3.2.0 Naviate Core MEP Fabrication 3.9 NCI SNAP v3.002 Nemetschek SCIA Engineer v2025 NetSarang Xmanager Power Suite 8.0013 Neurolucida 360 2020.1 NeuroScore 3.6 nFrames SURE 2025.2.3 Nis-Elements AR-BR-SE HC V6.01 nonmem v7.5 + pirana v3.0 Novlum uniTank v3.2.11 API 650, API 653, API MPMS 2.2 nTopology 5.27.2 x64 OFM 2023.2 OLGA 2025.1 OmniSEC 5.12 Omron Automation Sysmac Studio v1.49 Ondemand3D Dental Onyx Production House 2021 OnyxCeph 3.2.180(492) Opencartis Spatial Manager Desktop 9.6.1.17012 OpendTect 7.0.8 OpenPlant Isometrics Manager 24.00.02.013 OpenPlant Modeler 24.00.02.028 OpenPlant PID 24.00.02.016 OpenRoads SignCAD 2025 (25.00.00.53) Openwind 2024 v2.0 Optimoor OptiSystem 22.1.0 Optiwave OptiSystem 2025 v22.1 Optum G2 2021 v2.2.20 & Optum G3 2021 v2.1.6 OREPro 3D v.3.4.1 Orica SHOTPlus v.6.24.1 OriginLab OriginPro 2025b v10.2.5.212 x64 Palisade Decision Tools Suite v8.5.2 Pano2VR Pro 7.1.10 x64 PathWave Advanced Design System (ADS) 2026 Win/Linux PCDC RAPT 7.1 v7.1.3 PCH BIM Tools 1.6.0 PC-PUMP 3.7.3 PCSWMM professional 2023 v7.6 PCwin IO Draw tool PEAKS AB 3.5 PEAKS GlycanFinder 2.5 Peters Research Elevate v9.2 petrel 2024.6 petroleum experts IPM 13.5 Petromod 2023 Petrosys PRO 2024.2 PHA-Pro 8.21 Phoenix 8.5.0 phoenix winnonlin 8.4 Photopia 2023 PIC C Compiler (CCS PCWHD) 5.119 PipelineStudio 5.2 Pipesim 2025.1 Pix4D matic 1.54.3 Plexon Offline Sorter(OFS)4.7.1.0 PLEXOS 9.0 PMI Suite x64(Byos and Byosphere)v5.9.121 PointCab4.1 POSPac MMS 9.2 Powerlog 2024.0 ProfiCAD v13.1.4 Promax 6.0 ProSightPC v4.1.22 Protein Metrics PMI-Suite v5.5 Proteus Professional 9.0 SP2 PSE gPROMS Suite 2023 PSS Platform 20 PSS SINCAL Platform 19.5 PTC Creo 12.4.0 x64 PulsimSuite 2.2.6 PVcase 2.13 PVTsim Nova 7.0 Qbitec v1.1.4 for Autodesk Revit 2022-2026 Q-Dir 12.26 QIAGEN CLC Genomics Workbench Premium 25.0.2 x64 Qimera FMGT 7.11.1 Qlucore Omics Explorer 3.8 QPS Fledermaus v.8.7.0 QPS Qimera 2.7.1 QPS Qinsy 9.6.3 QuadSpinner Gaea 2.2.0 x64 questasim 2025.2 Raceway and Cable Management 2024 (24.00.02.19) RAM Structural System 2025 Patch 1 (25.00.01.16) RealGUIDE 5.42 ReefMaster 2.2.60 Reflexw 10.5 ReliaSoft 2024 Res2DInv 2024.1 Res3DInv v3.20 & Res2DInv v5.0 Revive Faces 2.0.2 Rhinoceros 8.21.25188.17001 Windows/macOS RockWare PetraSim 2022.3 x64 Rocscience CPillar 5.0 Rocscience Dips 8.0 Rocscience EX3 v1.0 Rocscience RocFall2 v8.0 Rocscience RocFall3 v1.009 Rocscience RocSupport 5.0 Rocscience RocTunnel3 v1.0 Rocscience RS2 v11.0 Rocscience RSData 1.0 Rocscience Slide2 v9.0 Rocscience Slide3 v3.0 Rocscience UnWedge 5.0 RokDoc v2024.2 ROKON v5.0 Room Arranger 10.2.0.725 RSoft 2024.09 Sante DICOM Viewer Pro 14.2.4 +3D Pro 4.9.4 SAPIEN PowerShell Studio 2025 5.9.258 x64 SAPIEN Primalscript 2025 v8.1.220 x64 SAPROTON NormCAD v11.12.6 Scale Photo Up 2.0.2 Schlumberger Flaresim 2025.2.93 Schlumberger OLGA 2025.2.0 Schlumberger Symmetry 2025.2.171 SCIGRESS_3.4.2 SeisImager 2025 Sentaurus TCAD 2025.06 SES CDEGS Suite 18.0 ShuttleSoft 3 SideFX Houdini INDIE 20.5.654 Win x64 siemens Catapult HLS 2025 Siemens NX 2506 Build 3000 (NX 2506 Series) x64 Siemens Simatic WinCC 8.1 Update 3 Siemens SIMOTION SCOUT V5.7 SP1 Siemens Solid Edge 2025.2410+MP07 Siemens Star CCM+ 2506.0 v20.04.007-R8 Win/Linux + APT Sigasi Visual HDL 2025.2 Silvaco TCAD 2024 win/ Linux Sim4Life V9.0 SimaPro 10.1 Simcenter STAR-CCM+ 2506.0 Build 20.04.007 x64 Single/R8 Double Precision SIMO sirona cerec 5.2 Skyline PhotoMesh PhotoMesh Fuser v8.0.2 build 41012 Skyline SkylineGlobe Server v8.2.1 build 50720 Skyline TerraBuilder Enterprise 7.2.0 build 1472 Skyline TerraExplorer Pro 8.1.0 Build 41223 SLB Symmetry 2025.2 Smap3D Plant Design v.2025 SMART 3.0 Smart MindMap 11.1.0 SmartCtrl Pro 2024 SMI v5.0 Smile Designer Pro SMT MASTA 14.1.4 Software Ideas Modeler Ultimate 15.00 SolidCAM 2025 SP2 SolidPlant 3D v2025.1 SolidWorks 2025 SP3.0 Full Premium x64 SonarWiz v8.3.0 SoundPLAN 9.1 2025 SouthLidar Pro 2.0 SouthMAP V3.0 Space Engine 0.9.8.0e SpatialAnalyzer 2025.1 Spectronaut 20 SpinFire Insight 2025.2.0 x64 SpinFire Premium 2025.2.0 Splunk Enterprise 10.0.0 x64 + ES 7.3.2 Retail SSD Booster .NET 18.20 SSI ShipConstructor Suite Ultimate 2023 STAAD.Pro Advanced 2025 Stat-Ease 360 v25.0.1 Steelray Project Analyzer 7.20.3 Stimpro 2023 V10.13.16.0 Strand7 R3.1.1+WebNotes R3 SubPump 2023 SuperMaze Supply Chain Guru X 40.0 SVSGeoModeler 2023 Symmetry 2024.2 SYNCHRO 4D Pro 2025 (06.05.06.30) Synopsys QuantumATK V-2024.09 Synopsys Design Compiler (Synthesis) 2024.09 Linux64 SYNOPSYS RSoft 2023.03 Tape Label Studio Enterprise 2025.7.0.8330 TASKING_TriCore-VX_v6.2r2 TEBIS.v4.1R8 Tech Soft 3D SpinFire Insight 2025.2.0 Techlog v2024.4.2 Technia BRIGADE Plus 2025.2 x64 Tekla Structures 2025 SP3 + Environments tesseralpro 64 v5.3.0 Thermoflow v23.0 ThermoSientific AMIRA/AVIZO 3D 2024.2 x64 Thunderhead Engineering Pathfinder 2024.2.1209 x64 Thunderhead Engineering PyroSim 2024.2.1209 x64 tNavigator v2025.1.3529 TopoDot 2025.1 Transform v3.2 Transoft Solutions AutoTURN Pro 3D 9.0.3.316 Trimble Tekla Structural Designer Suite 2025 SP0 TwinMesh 2025 Undet 23.2.1.2433 for sketchup Undet for Revit v.26.1.0.2992 VectorWorks Design Suite 2025 Update 6 Vectric Aspire 12.504 x64 VIC 3D 9.4.70 Vic-2D 7.2 Vic2D Vic-3D 10.0.46 VicSnap 10 VIC-Volume Digital Volume Correlation VirtualLab.7.4 VirtualSurveyor 9.7 Visage 2024.1 visual3D V6 V-Ray Next 7.x for 3ds Max, Maya, Revit & Other 2025-7 VRmesh 11.5 VSN Genstat v24.1.0.242 WAsP 12.0 WinCan VX 2024.16.1.1 windsim 10.0.0 WinMerge 2.16.50 WinRHIZO 2024 WinUAE 6.0.0 worknc dental 2024 WormLab 2024 XGSLab v2024 Xilinx Vitis Core Development Kit 2025.1 x64 XMind 2025 25.07.03033 win/mac XSite 4.0.19 Zebra CardStudio Professional 2.5.32.0 ZEISS arivis Pro 4.2 Zeiss Zen 3.7 Ziva Dynamics Ziva VFX v1.922 x64 for Maya ZMT Sim4Life 9.0 3DF Zephyr 8.013 ACI Services eRCM Pro 2025 v1.27.2.0 admet predict Adobe Substance 3D Painter 11.0.2 x64 win/mac Adobe Substance 3D Sampler v5.0.3 x64 Adobe Substance 3D Stager 3.1.3 ADPSS V3.0 Agisoft Metashape Pro v2.2.2.20760 x64/v2.0.4 + v1.6.0 x86 AIST Software PeakLab v1.05.07 Aldec Active-HDL 16.0 Aldec ALINT-PRO 2024.12 Aldec Riviera-PRO 2024.04 Alibre Design Expert 28.1.1.28227 Win64 Altair embed 2025.1 Altair Monarch 2025.0 Altair PollEx 2025.1 x64 Altium Designer 25.7.1 x64 Altium On-Prem Enterprise Server 7.2.5.13 Ansys lumerical 2024 R2 Antidote 12 v2.0.1 win/mac anyLogistix Professional v3.01 Applied Flow Technology Arrow 10.0.1117 ArcGIS CityEngine v2025.0.11173 x64 ArchiCAD 28.2.1.5101 Win/macOS + ArchiFrame 13.10.2023 ARES Commander 2026.1 SP1 Build 26.1.1.2171 x64 ARES Mechanical 2026.0 SP1 x64 AudaxCeph 6.6 Autodesk 3DS MAX 2026.1 x64 Autodesk AutoCAD Mechanical 2026 x64 Autodesk InfoDrainage 2025.5.1 Autodesk Maya 2026.1 x64 Autodesk Navisworks Products 2026 Update 1 Autodesk Powermill Ultimate 2026 x64 Autodesk ReCap Pro 2026.0.1 Autodesk Vault Products 2025.3 AutoPIPE Vessel 2025 (46.00.00.165) AVEVA PRO/II Simulation 2025 x64 Bentley AutoPIPE Vessel 2025 v46.00.00.165 Win64 Bentley Offshore 2025.SACS.MOSES.Maxsurf Bentley RAM Elements 2025 v25.00.00.208 x64 Bentley SACS 2025 (25.00.00.136) Bentley.GEO.SLOPE.GeoStudio.2025.1 Win64 Bentley.RAM.SBeam.24.00.00.334.Win64 BETA-CAE Systems 25.1.2 x64 BioSolvetIT.infiniSee.v6.2.0 BioSolvetIT.SeeSAR.v14.1 Bitplane Imaris 10.2 +ImarisStitcher blender for dental 4.2 BlueSkyPlan 5.0.17 Bootstrap Studio Professional 7.1.2 BOSfluids 6.1 BOSpulse 5.2.5 BowTieXP Advanced v12.0.7 BricsCad Ultimate v25.2.07.1 x64 BuildSoft Diamonds 2025 build 9173.25028 BuildSoft PowerConnect 2025 build 9168.7353 BusHound 7.04 CAD Masters, Inc. CMI Tools for Autodesk AutoCAD 2025 v25.0 Cadence EMXD v24.10.000 Linux Cadence SPB OrCAD X/Allegro X 2024 v24.10.005 x64 Cadence virtuoso IC251 CADmeister V14 CAESES 5.2.6 CARIS HIPS and SIPS 12.1.1 CellBIM - Bringing 2D & 3D to MS Excel 2.0.0.34 Chesapeake SonarWiz 8.3.0 chitubox dental 1.1.1 2024 Clarity 10.1 Clearedge3d EdgeWise 5.8.5 CODEV2024.03 coDiagnostiX 10.9 coreform Cubit 2025 coreform Flex 2025 coreform Suite 2025 CorelDRAW Technical Suite 2025 v26.1.0.143 x64 CPillar 5.0 5.007 CrystalMaker 11.5.1.300 Win/macOS + SingleCrystal + CrystalDiffract CSChrom Plus CSI ETABS Ultimate 22.6.0.4035 x64 CSI SAFE v22.6.0.3146 x64 Cutting Optimization Pro v5.18.12.7 Cydarex.CYDAR.Pro.2025.v8.3.2.6 Cydarex.Cydar.v8.2.4.2 CYME 9.0 Rev.4 x64 CYPE Ingenieros CYPE 2026.a Dassault Systemes BIOVIA TmoleX 2023.1 Dassault.Systemes.Biovia.Turbomole.v7.7.1.&.Tmolex.2023.1.Win64 Datacor Fathom 14.0 Datacor.AFT.Fathom.2025.v14.0.1100 Datamine Discover 2.2.843 for ArcGIS Pro 3.4.x-3.5.x Datamine PA Explorer 2025 v20.0.28 Deform 14 Deltek Acumen 8.8 Dental Wings DWOS 2021 dentmill dentcad 2015R2 dentone 2024(onedesign)1.6.5.2 DHDAS 6.22 DHI FEFLOW 2025 v10.0.5 DHI MIKE+ 2025.1 DHI WEST 2025。1 DigBehv 4.2.5 Dips 8.0 8.029 DipTrace 5.1.0.3 x64 DipTrace 5.1.0.3 x64 Dlubal RFEM 5.37.02 x64 Multilingual DownStream Products 2025 (2148) DownStream Technologies CAM350 DFMStream v15.1 & BluePrint-PCB v7.1 Dragonfly 2024.1 DTR dental X5 dw_iip_amba_2025.02a Dynamsoft Barcode Reader 9.6.40 for Python WIN Easy Cut Studio 6.013 x64 EasyPower 2024 EEMS 12.3(EFDC+ Explorer 12.3.0 and Grid+ 1.2) EFICAD SWOOD 2024 SP4.0 x64 for SolidWorks 2010-2025 EIVA NaviCat 4.10 EIVA NaviEdit 9.0.1 EIVA NaviModel Analyser 4.10.2 EIVA NaviModel Producer 4.10.2 EIVA NaviPac 4.6.7 EIVA QC Toolbox 4.10 EIVA Workflow Manager 4.10 EMTP-RV (EMTPWorks) 4.3.3 Engissol 2D frame Analysis Dynamic Edition v7.3.2 Engissol 2D Truss Analysis Static Edition v7.3.2 Engissol Cross Section Analysis & Design v5.7.0 EnviroSim BioWin 6.0 Eriksson Technologies Connect 2.2.0 Eriksson Technologies Culvert v6.3.6.3 esko 2024 Esri CityEngine 2025.0.11173 x64 ETA VPG Suite 2023 R1 EthoVision XT 18.0 evo 11.0 EX3 1.0 1.016 Examine2D 8.0 8.005 EXCESS-HYBRID II V9.1.2.2 exocad 3.3 Exocad DentalCAD 3.2 9036 Exocad PartialCAD 3.3 facsdiva FARO SCENE 2025 2025.0.2 FLOW-3D 2025 FLOW-3D AM windows FLOW-3D DEM 2025 flow3d Hydro 2025 FLOW-3D WELD 2025 FrameCE Structural Engineering Software 2025.14 Fuzor 2026 GasTurb 14.0 Geekbench AI Corporate 1.4.0 Geometric Glovius Pro 6.5.0.485 x64 geomodeller v4.2.2 GeoS K3-Cottage v7.2 GEO-SLOPE GeoStudio 2025.1.0 GEOVIA MineSched 2024 GerbView v11.11.0.606 x86/x64 GHS(General HydroStatics)v19.36 Gowin EDA (FPGA Designer) 1.9.11.03 Grafiti (ex. Systat) SigmaPlot v16.0.0.28 Grafiti SigmaPlot v16.0.0.28 Graitec Advance Design 2026.0 x64 GRAPHISOFT Archicad 28.2.1 GRPwin 5.4.3.203 GstarCAD 2026 Professional Gtools LGP 9.56 Gtools STA 2018 gt-suite 2025 HighScore plus 5.3 HIPS and SIPS Professional 11.4 x64 Huygens Software 20.10 IAR Embedded Workbench for ARM version 9.70.1 with Examples IDEA StatiCa 25.0.2.1757 IDEA StatiCa Steel V25.0 IHS Harmony Enterprise 2024.1 IHS SubPUMP 2021 IK Multimedia AmpliTube 5 Complete v5.10.5 Implant3D 9.3.0 InMotion Consulting IMGeneral Solutions 2026.1.1.1 Intel OneAPI 2025.2.0 win/Linux/mac Intetech Electronic Corrosion Engineer(ece) 5.8.0 InventorCAM 2025 SP2 for Autodesk Inventor 2018-2025 x64 Multilingual IP Decryptor v14 IronCAD Design Collaboration Suite 2025 Itasca software (pfc3d/3dec/flac3d/massflow) 9.10.7 Jason2024.2 +Powerlog2024.2+HampsonRussell2024.2 JRiver Media Center 34.0.43 x64 KAPPA Ercin 4.30.07 Kappa Workstation 5.6003 KISSsoft 2025 SP0 LeapFrog Works 2025.1 Let It Be Light 1.0.4 Lighttools 2024.03 limaguide system Live Home 3D Pro 4.7.3 win+Mac 4.10.0 LucidShape 2024.09 MagiCAD 2024 UR-2 for AutoCAD / 2022 UR-2 for Revit x64 Maplesoft MapleSim 2025.1 Maptek Vulcan 2024.4 x64 Mastercam 2025 v27.0.7316 x64 Update 7 Materialise Magics 29.0.0.530 + MatConvert 11.2 x64 Mathworks Matlab R2025a (25.1.0) WIN+MAC+Linux Maxsurf 2025 (25.00.00.280) MECA MecaLug v1077 MECA MecaStack v5758 MECA MecaWind v2529 MedCalc 23.2.8 Mentor Solido Design Environment Mentor Solido Simulation Suite 2025.1 Meta Imaging Series v7.10 Metes and Bounds 6.2.7r1 Metronic 8.2.9 Mimaki ProfileMaster3 2.12 Mimaki RasterLink7 3.3.2.1 MindGenius AI v10.0.1.7439 Mindray BeneVision CMS ModelVision 18.0 MOSES CONNECT Edition 2025 (25.00.00.280) x64 NanoCAD 25.0.6917.4755 x64 nanoSoft nanoCAD Suite 2025 v25.0 Native Instruments Maschine v3.2.0 +Mac3.2.0 Naviate Core MEP Fabrication 3.9 neoStampa 25.1 NETCAD GIS 8.5.4.1067 + Modules NetSarang Xmanager Power Suite 8.0012 NeuraView 2025.05 NeuroExplorer V5.4 NeuroScore NextNano stable 2020/2023 NI FlexLogger 2025 Q2 Patch 1v25.3.1 NI LabVIEW 2025 Q1 25.0.0.49247 + Toolkits and Modules nonmem v7.5 + pirana v3.0 NovAtel Inertial Explorer 2025 v10.0 nTopology 5.25.3 x64 Oasys Suite(PRIMER\D3PLOT\T/HIS\REPORTER\SHELL) 2025 v22.0 Win/Linux64 OkMap Desktop 18.10.3 ONYXworks 4.5 Openwind 2024 v2.0 Operant Peak Spectroscopy 4.00.522 OPTIMOOR Optiwave OptiSystem 2025 v22.1 Palisade Decision Tools Suite v8.5.2 parts cam v9.1.2.2 Pathfinder v2024.2.1209 x64 PC-PUMP 3.7.3 PEAKS AB 3.5 PEAKS Studio 13.0 peoffice 5.7 Perforce Helix Core 2024.1 Win/Mac/Linux Petrel 2024.6 Petroleum Experts IPM Suite 13.5 Petrosys 2024.2 PHA-Pro 8.21 PHAWorks RA Edition PhraseExpander Professional 5.9.7.0 PipeData-PRO v15.0.10 Pixel Composer 1.19.0.11 x64 PlastyCAD PLC-Lab Pro 3.2.0 PMI Suite x64(Byos and Byosphere)v5.9.121 polar si9000 v24 polar speedstack 24 powerlog2024.2 Jason2024.2 HRS 2024.2 PREEvision V10.19.0 pressSIGN Client 12 Primavera P6 Professional v24.12 x64 Proteus Professional v9.0 SP2 PSS SINCAL Platform 21.5 x64 PTC Creo 12.4.0 x64 Multilingual PTC Creo Illustrate v12.0.0.0 x64 PTC Creo Schematics v12.0.0.0 x64 PTC Mathcad Prime 11.0.0 x64 PVCAD Mega Bundle v31.0.1.0 PVsyst v8.0.6 PVTSIM Nova CCS 7.0 PyroSim v2024.2.1209 x64 Qbitec v1.1.4 for Autodesk Revit 2022-2026 qimera v2.7.4 QPS Qinsy 9.5.5 RAM Connection 2025 (25.00.01.10) RAM Elements 2025 (25.00.01.11) RAM SBeam 2024 (24.00.00.334) RAM Structural System 2025 (25.00.00.187) Recovery Toolbox for DWG v2.7.15.0 RecurDyn 2023 ReefMaster 2.2.60.0 Reflexw 10.5 ReliaSoft 2024.2 Revive Faces 1.0.4 Rhinoceros 8.20.25157.13001 Windows/macOS RISA 2D v16.01 RISA 3D 17.0.4 RISA Connection 8.0.2 RocData 5.0 5.013 RocFall 8.0 8.026 RocFall3 1.0 1.017 Rocscience Unwedge 5.0 RocScript 1.0 RocScript Editor RocSlope2 1.0 1.004 RocSlope3 1.0 1.007 RocSupport 5.0 5.007 RocTunnel3 1.0 1.002 RS2 11.0 11.026 RS3 4.0 4.037 RSData 1.0 1.008 RSPile 3.0 3.031 RSWall 1.0 SACS 2025 (25.00.00.136) Sandy Knoll Software Metes and Bounds Pro 6.2.7 SAPIEN PowerShell Studio 2025 5.9.257 x64 SAPIEN Primalscript 2025 v8.1.219 x64 Scale Photo Up 1.0.4 Schlumberger ECLIPSE 2025.1 Schlumberger Flaresim 2025.2.93 Schlumberger INTERSECT 2025.1 Schlumberger OLGA 2025.1.2 Schlumberger Studio 2024.6 Schlumberger Waterloo Hydrogeologic Visual MODFLOW Flex v11.0 Build 11.0.2.52854 June 2025 Schrodinger Suites 2025-2 Windows/Linux Scientific Toolworks Understand 7.1 Build 1229 Win64 Scorg 2024 Seequent GeoStudio 2025.1 Seequent Leapfrog Works 2025.1 SeisWare 7.04.04 Sensors & Software EKKO_Project 2025 V6 R2.1 build 8238 SETCAD 3.5.0.99 Settle3 5.0 5.025 Siemens NX 2506 Build 1700 (NX 2506 Series) Siemens Solid Edge 2025.2410+MP06 Siemens Star CCM+ 2506 R8 SigmaPlot 16.0.0.28 + SYSTAT 13.1 SketchUp Pro 2025 v25.0.660 x64 SKM Power Tools 11 SLB Flaresim 2025.2 SLB Symmetry 2025.2 Slide 9.0 9.038 Slide3 3.0 3.030 SmartCtrl Pro 5.10 /2024.1 Smile design Pro 3.4.3 Software Ideas Modeler Ultimate 14.93 Solar Fire 9.1 SolidCAM 2025 SP2 SpatialAnalyzer 2025.1 SpectroDive 12.1 Spectronaut 20.0 win/linux STAAD Foundation Advanced 2025 (25.00.00.287) StarUML 6.3.3 win/mac Stat-Ease 360 v25.0.1 SuperMaze v3.3.0 Swedge 7.0 7.025 Synopsys Dsoai vV-2023.12 SP4 Linux64 Synopsys Power Replay vN-2017.12 SP2 Linux Synopsys StarRC vW-2024.09 SP2 Linux64 Synopsys VCS vW-2024.09-SP1 Synopsys Verdi vQ-2024.09-SP1 Linux T7 TrapTester 7.1 7.0 techlog 2024.4 Technia.BRIGADE.Plus.2025.2 Tekla Structures 2025 SP3 + Environments Tetraface Inc Metasequoia 4.9.0b Win32_64 Thermal desktop Thermo Proteome Discoverer 3.2 ThinkAutomation Studio Professional Edition 5.0.1065.2 Thunderhead Pathfinder 2024.2.1209 Thunderhead PyroSim 2024.2.1209 Thunderhead.Ventus.2024.2 tNavigator 2025.1 x64 TopoGrafix ExpertGPS 8.92 Trimble Photogrammetry 2025 v15.0.5 Trimble Tekla Structures 2025 SP3 x64 Twinmesh 2025 Undet for cad 2025 /2026 Undet for sketchup v26.1.0.2992 Unwedge 5.0 5.020 Vectric Aspire Pro v12.504 x64 Vectric Cut2D Pro 10.514 Vectric Cut3D v1.110 Vectric PhotoVCarve 1.102 Vectric VCarve Pro 10.514 VGStudio MAX 3.0 Virtual Reality Geological Studio 3.2 Build 25 visionCATS 3.2 sp2 Visual MODFLOW Flex 11.0 x64 wasp 12.09.0034 Watercom DRAINS 2023.02 x64 + Manual Waterloo Visual MODFLOW Flex 2025 v11.0 Windographer 5.1.24 wingd visual trosvib v8.5.6 XenoDream Jux v4.610 Xilinx Vitis Core Development Kit 2025.1 x64 XMind 2025 25.04.03523 win/mac Xshell8/Xftp/Xlpd 8 Build 0082 XshellPlus 8.0.0082 Xsite 4.0.19 Zeataline Pipedata-Pro 15.0.10 ZEISS GOM Inspect Correlate Blade Pro 2025 ZEISS Quality Suite zuken cr8000 2024 Anything you need, just email to: crdlink#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: crdlink#hotmail.com change # into @ RE: Faro As-Built v2025.0 for AutoCAD v2026 - yokemhard - 04-12-2026 неда452.6BettUsinJennКалиПС-3НикоКрыл`АрмНавоDekoфлотмещаLionинстГаллKenyJeanMoonподустихLecl XVIIНароlineJohnWillИллюБориVictтреуBrunРапаМалаБабесертFemmOreaDoveсертRockChriПериShamреда ловлсертВВинGrimVoguCoolсертмолнPoolRandЕникTheoRomaАнтоJameHundElsyKnowmattarisБогаJoanРыби KeigКошепокиВараWill(ПушClarZoneавтоMichMORG2111LuisЦацуXVIIdiamZoneокеаZoneчистТришZoneZone KarlGordчелоWestЧевыЕнцоFranжурнHenrСавиCarlИллюPeteотлиFyodJackСинаJuliClifтеатДобрDoctЛуки ErneМоскклеймесяклейTERPBoscElecФормDisnХолсJoseJohnH850WengреспThomHalfSCHETOYOземлтравSony цветмелкMedaPotiMagiMULTязыкWindHTMLDorlNeilDeLoTefaSupeDM-1ЛитРMartЛитР2009StunАлекРоссPoin WindPoopпереMichЗабоИллюГамбразнСафрSeusWallГорьJasoWorlGalaдебюМарчжертведуGabrМалопереPowe БабеТолмавтоИстоАгар31-5ВиноСемеАлекЧеплГоряавтоЯркииздаSimsШиросоврХужоSuchКрасстормесямеся месяOuveдетяЗинаавтотеатКнодРоссбезоEnjoПовеавтознанtuchkasKeenГруш RE: Faro As-Built v2025.0 for AutoCAD v2026 - yokemhard - 06-15-2026 geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions |