![]() |
|
NAPA designer 2025.1 - Printable Version +- Grand Theft Auto Forum (https://gta.how) +-- Forum: Grand Theft Auto Games (https://gta.how/forum-1.html) +--- Forum: GTA 6 News & Rumors (https://gta.how/forum-2.html) +--- Thread: NAPA designer 2025.1 (/thread-66558.html) |
NAPA designer 2025.1 - Romdastt - 02-09-2026 Anything you need, just email to: crdlink#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: crdlink#hotmail.com change # into @ Adobe Substance 3D Designer 15.1.1 x64 win/mac x64 Adobe Substance 3D Modeler v1.22.6 (x64) Adobe Substance 3D Painter 11.1.2 x64 win/mac Adobe Substance 3D Sampler 5.1.3 x64 win/mac Adobe Substance 3D Stager 3.1.7 adpss 3.1 Air Quality Calculator 1.0.1 Akcelik SIDRA Intersection 2025 v10.0.6.236 Aldec ALINT-PRO 2025.12 Altair Analytics Workbench 2026.0 Win/Linux Altair Compose 2026.0 Linux64 Altair EDEM Professional 2026.0 x64 Altair Embed 2026.0 x64 Altair FEKO 2026.0 x64 Altair Flux & FluxMotor 2026.0 x64 Altair GateVision PRO 2026.0 Win/Linux64 Altair Grid Engine 2026.0 Linux Altair HW FEKO 2026.0 x64 Altair HWDesktop 2026.0.1 x64 Altair HyperWorks Desktop 2026.0.1 x64 + Solvers + Help Altair Inspire 2026.0 x64 Altair Inspire Cast 2026.0 x64 Altair Inspire Extrude 2026.0 x64 Altair Inspire Form 2026.0 x64 Altair Inspire Mold 2026.0 x64 Altair Inspire PolyFoam 2026.0 x64 Altair OmniV 2026.0 Altair PollEx 2026.0 x64 Altair Pulse 2025.1 Altair RTLVision PRO 2026.0 Win/Linux64 Altair S-Frame Suite 2026.0 Altair SimLab 2026.0 Linux64 Altair SimSolid 2026.0 x64 Altair SpiceVision PRO 2026.0 Win/Linux64 Altair StarVision PRO 2026.0 Win/Linux64 Altair Sulis 1.12 Altair Twin Activate 2026.0 x64 Altium Designer 26.2.0.7 x64 AltoQi Builder + Eberick 2025.04 AMETank 18.12.06 Analyst 1.7.4 ANSYS Clock FX 2025R2.2 Linux64 ANSYS Diakopto 2025R2.2 Linux64 ANSYS Electromagnetics Suite 2025R1 Linux64 ANSYS Helic 2025R2.2 Linux64 ANSYS Lumerical Suite 2025R1 Linux64 ANSYS Path FX 2025R2.2 Linux64 ANSYS PathFinder-SC 2025R2.2 Linux64 ANSYS PowerArtist 2025R2 Linux64 ANSYS Redhawk-SC 2025R2.2 Linux64 ANSYS SCADE19 ANSYS SeaScape 2025R2.2 Linux64 Ansys Systems Tool Kit (STK) Pro Premium 2025 v13.0 x64 ANSYS Thermal Desktop 2025 R2 ANSYS Totem-SC 2025R2.2 Linux64 AnyDWG Software DGN to DWG Converter 2027.0 AnyDWG Software DWG DXF Converter 2027.0 AnyDWG Software DWG to DWF Converter 2027.0 AnyDWG Software DWG to SVG Converter 2027.0 AnyDWG Software PDF to DWG Converter Full 2027.0 anyLogistix Professional 2026 v3.4.2 ANY-maze 7.61 AnyRail 7.140 Applied Imagery Quick Terrain Modeler 8.4.4 Aquaveo Groundwater Modeling System Premium v10.9.2 Win64 Aquaveo Watershed Modeling System v11.3.6 Arena Simulation Pro 16.1 ARES Commander 26.3.1.4145 x64 Artifact Interactive Garden Planner 3.8.82 ASDIP Steel/Foundation/Concrete/Retain/Wood 2026 ASDIP.Wood.v.3.3.2.2 AspenTech aspenONE Suite 2025 v15.0 AtaiTec SI Suite 2025.12 Autodesk AutoCAD 2025.1.2 (x64) win/mac Autodesk EAGLE Premium 9.6.2 AutoDWG DWGSee Pro 2027 v6.61 AutoForm Forming R13.0.1 AVEVA E3D Design (Everything3D) 2025 v3.1.10 AVEVA Marine 12.1 SP4.64 AVEVA Production Accounting 2025.2 Awesome Miner Ultimate 11.3.4 AWR Design Environment 25.10.030 BETA-CAE Systems 25.2.0 x64 BIMware MASTER EC2 Reinforcement 2026 15.2.0 BIMware MASTER EC3 Steel Connections v15.2.0 biowin 6.4 BOSpulse 6.0.1 BowTieXP 12.0.8 Bricsys BricsCAD Ultimate 26.1.08 x64 win/mac Bricsys PowerPath v25.2.08 C3D Labs CADEX CAD Exchanger v3.24.16 Cabinet Vision 2025.4 Cabmaster v2025 Cadaplus APLUS v25.113 Cadence AWR Design Environment v25.10.030 Win64 Cadence CONFRML 25.1 Linux Cadence Design Systems Analysis Sigrity 2025 25.10.000/ 2024 Cadence Digital Design Implementation (DDI) System 25.11.001 Cadence Fine/Marine 2025.1 Linux64 Cadence QUANTUS 25.1 Linux Cadence System Analysis Sigrity 2025 v25.10.000 & HF010 25.10.100 Win64 Cadence Virtuoso Studio IC25.10 (25.10.000) Linux Cadfil 9.84 CadnaA 2023 Cameo Enterprise Architecture 2026x Hotfix1 CAMMaster Designer v11.24.73 CAMWorks 2026 SP0 x64 CAMWorks ShopFloor 2026 SP0 Carbon Footprint Check 1.0.1 Carlson MapWorks v14.0.1.1 Carlson Precision3D 2025 Carlson Survey OEM 2026 Carlson ToolPac v25.0.1.0 Carlson WD2CAD v4.3.1.6 Carlson XL2CAD v8.3.1.8 CATALYST 3.3 CATIA V5-6R2023 (V5R33) SP4 Win64 CentOS8.5 EDA-vm 2025 Certara Phoenix 2026 v8.7.0 CFTurbo v2026 R1.1.128 + CFTurbo FEA v2026 R1.0 x64 CGSim 11.1 Chaos Vantage 3.1.1 x64 CHECKSTEEL v4.1.6 CHECKWIND v8.4.2 Chemcraft 1.8 Build 762b 2025 Chessbase 26.5 CityEditor for SketchUp 4.1.0 CLC Genomics Workbench Premium 26.0.1 Win/Linux Cloanto Amiga Forever Plus Edition 11.2.4 Cloanto C64 Forever 11.2.23Plus Edition COAA PlanePlotter 6.7.4.1 ComPhysics E2M-Win Professional v1.0.1 x64 CONVERGE CFD Bundle 5.1.1 Converge Studio 5.1.1 CoPRA 13.1.1 COSMOlogic COSMOthermX 19.0.4 & TmoleX 4.5.3 Coventor SEMulator3D 11.2 x64 CPFD Barracuda Virtual Reactor 25.1.1 Cradle CFD 2025.1 Crosslight 2024 CSI Bridge Advanced with Rating v26.3.0 build 3324 (x64) CSI CSiCol v12.0.0 build 1206 CSI ETABS v23.1.1 build 4293 Win64 CSI Perform3D 11.0.0 CSI SAFE 23.1.1 CSI.XRevit.2026.0.238 CST Studio Suite 2026 SP1 CurveExpert_Pro_2.6.5_x64 -customcompiler 2024.09, dve 2025.06, license Cutting Optimization Pro 5.18.19.3 Cyclone 3DR v.2026.0.0.49047 Cyclone FIELD 360 Dassault Systemes SIMULIA CST Studio Suite 2026 Win64 Datamine PA Explorer 2025_20.0.13 DAZ Studio Professional 4.24.0.4 DecisionTools Suite Industrial 8.12 Deep Excavation HelixPile 2025 v25.0.5.4 Deep Excavation PileDVR 2019 v19.0.1.1 Deep Excavation QuayWalls 2025 v25.0.11.1 Deep Excavation RetainEX 2025 v25.0.7.7 Deform 14.0 DesignBuilder 2025.1 Design-Expert 13.0.5.0 x64 Deswik Nova 2025.6 Diamond Cut Forensics Audio Laboratory v11.09 Dirac 3.0 DNV GeniE 2025 v9.0 DNV GL Phast Safeti v9.11 DNV GL SIMA 4.8 DNV HydroD 2025 v8.0 DNV Nauticus Machinery 2026 v16.0.0 DNV Phast&Safeti 2025 v9.11.0 DNV Sesam Wind Manager 2025 v8.0 DNVGL Leak 3.3 DNVGL Maros 9.3.1 DNVGL Nauticus Hull FEA 2025 v20.30 DNVGL Nauticus Hull Prescriptive 2025 v20.30 DNVGL Nauticus Machinery 2026 v15.0 DNVGL Phast&Safeti 9.11.0 DNVGL Sesam GeniE 8.12-03 DNVGL Sesam HydroD 7.3-01 DNVGL Sesam Jacket Design 2025 DNVGL Sesam Marine 2025 DNVGL Sesam Package 2025 DNVGL Sesam Pipeline Tools 2025 DNVGL Sesam Topside Design 2025 DNVGL Sesam Wind Manager 7.2-00 DNVGL Sima 4.8.0 DNVGL Synergi Plant RBI Onshore 5.6 DNVGL Tero 5.3.1 Draftable Desktop 26.1.0 DS CATIA P3 V5-6R2023 SP4 x64 DS SIMULIA CST Studio Suite 2026 SP1 x64 DS Simulia XFlow 2026 Build 124.01 x64 DS SolidWorks 2026 SP1.1 x64 -dve2024.09,license Dynamic_Web_TWAIN_17.2.1 Dynamita SUMO v24.0.1 EcoStruxure Control Expert v16.2 Edwards PumpCalc 5.4 EEMS 12.4 (EFDC+Explorer 12.4.1+Grid1.2) EFI Fiery XF 9.0 EIVA NaviCat 4.10.0 EIVA NaviEdit 9.2.0 EIVA NaviScan 9.10.0 EIVA Workflow Manager 4.10.0 Ekahau AI Pro 11.8.8 Elasticsearch Enterprise 9.2.4 Win/Mac/Linux EngiCalc - Engineering Calculator 1.0.1 Environment And Climate Prediction AI 1.0.0 Environmental Calculator 1.0.1 EnviroSim BioWin 2025 v6.4.3 EPLAN Electric P8 v2026.0.3.371 EPLAN Harness proD 2023.0.0.257 x64 ErgoLAB 3.17 Eriksson Technologies ETPier 2.61 ESG Climate Risks Engine 1.0.0 ESI ProCAST Suite 2025.0 ESRI ArcGIS Pro 3.6 Patch 1 Essential Macleod 11.9 Etap.PowerStation.v24.0.1.Win64 EViews 14 EVS(Earth Volumetric Studio 2026)2026.1.0 FactSage 8.3 faro cam2 10.6 FARO SCENE 2025 2025.2.1 FIFTY2 PeronLab 2026 v7.0.3 Filou NC Gorilla 2026.11.19 -fm2024.09, icc2 2024.09, spyglass2024.09, dc2024.09 Fritz 20.9 Frontline Excel Slver 2025 Frontline InCAM Pro 6.1 -fusioncomplier2024.09, customcompiler 2024.09 Futuremark 3DMark Professional 2.32.8826 FX Math Tools v26.01.14 x64 FX Science Tools v26.01.14 x64 gasturb 14 Geo magic design Geoactive Interactive Petrophysics 2025.3.2 GeoGebra 6.0.913.0 Geometric.Glovius.Prime.6.7.0.121.Win64 Geomur GEOVIA MineSched 2026 v9.11.0 GEOVIA Surpac 2026 x64 GEOVIA Whittle 2026 GibbsCAM 2026 v26.0.55.0 x64 Golden Software Grapher v26.1.314 2026 Golden Software Surfer v30.3.273 2026 Graebert.ARES.Commander.2026.SP3 Graitec BIMware Master 2025 v15.2 Graitec Master Suite (BIMware MASTER Suite) 2026 x64 Greenhills multi 2023 RH850/PPC/ARM/RISC/TRICORE/MIP GreenPower Designer 1.0.1 GrindEQ Math Utilities 2024 guidemia 7.0 HelixQAC 2024.2 Hexagon PV Elite 2025 v28.0 Hexagon.Intergraph.PepS(PIPESTRESS).2025.v08.00.00 HxGN MinePlan 2025.1 Release 1 x64 Hydromantis CapdetWorks 2025 v5.0 Hydromantis GPS-X 8.0.1 / Toxchem 4.3.6 / CapdetWorks / WatPro 4.0 Hydromantis GPS-X 9.0.5 Hydromantis Toxchem 2025 v5.0 Hydromantis WatPro 2025 v5.0 IAR Visual State 11.2.3 iBwave Design Enterprise 24.1.0.25 -IC(virtuoso)231.60, SPECTRE231, ASSURA41_231, XCELIUM2403 -IC(virtuoso)251, SPECTRE241, XCELIUM2403, license -icc2 2025.06, spyalass2025.06, dc2025.06, lc2025.06, IES ConcreteBending v8.00.0002 IES ConcreteSection v4.00.0003 IES QuickConcreteWall v5.0.0016 IES QuickFooting v5.0.0017 IES QuickMasonry v6.0.0008 IES QuickRWall v5.0.0017 IES ShapeBuilder v15.00.0001 IES VAConnect v7.00.0005 IES VisualAnalysis v23.00.0003 IES VisualFoundation v13.00.0002 IES VisualPlate v7.00.0002 IHS Kingdom Advanced 2025SP1 v19.1 Inertial Explorer 2025 v10.00 Intel Quartus Prime Pro 25.3 (x64) Interaction Design Lab Potsdam Fritzing v1.0.6 Win64 Interactive Petrophysics 2025 IPG Carmaker 12.0.1 IQSTAR 1.2 Irazu 6.3 2D/3D Itasca software (pfc3d/3dec/flac3d/massflow) 9.10.7 iTwin Capture Manage and Extract 25.00.03.02 Jason 2025 Jeppesen Cycle DVD 2603 Full World JMatPro 14.1 kappa workstation 5.40 +Emeraude Keysight EXata (Scalable EXata) Network Modeling 8.3.1 Win/Linux64 Keysight Exata 8.3.1 2025 Keysight Model Builder Program (MBP) 2026.0 Win/Linux Keysight Modeling MQA 2025U1 Keysight N1500A Materials Measurement Suite 2020 Keysight PathWave Vector Signal Analysis(89600 VSA) 2026 Keysight Physical Layer Test System(PLTS) 2025 KFX EXSIM 7.0 KiCad 9.0.7 Klocwork 12.3 Kongsberg K-Spice 2026 v25.6 Kongsberg LedaFlow Engineering 2026 v2.12 Krita Studio 5.2.15 x64 LDRA TestBed 9.8.1 Leica CloudWorx 2025.x for AutoCAD 2023-2026 Leica CloudWorx 2025.x for BricsCAD 22-26 Leica CloudWorx 2025.x for MicroStation 2023-2025 Leica CloudWorx 2025.x for Navisworks 2023-2026 Leica CloudWorx 2025.x For PDMS 12.1 SP4 Leica CloudWorx 2025.x For Revit 2023-2026 Leica CloudWorx 2025.x for Solidworks 2019-2024 Leica Cyclone 3DR v2026.0.0.49047 Leica Cyclone Enterprise v2025.0 Leica Cyclone HxMap 2025 v4.8 Leica Infinity 2025 v5.0.0 Leica PinPoint 4.4.1 Leica XPro 6.4.7В Let It Be Light 2.0.12 LightBurn v2.0.05 LightTools 2025.3 Limaguide Plus 2025 LimitState RING v4.2.0.34975 LiPowerline 9.0 Lloyd's Register (ex. Senergy) Interactive Petrophysics 2025 v25.3.2 Lloyd's Register (ex. Senergy) IP 2025 v25.3.2 LuBan 3D 04.01.2026 LucidShape 2024 MagiCAD 2026 UR-2 for AutoCAD / Revit 2021-2026 Maptek PointStudio 2023 Maptek Vulcan 2025.3 x64 Maptek Workbench 2025.1 MASTA 14.0 Materialise 3-matic (Medical) 2026 v20.0 Materialise e-Stage 2025 v8.0 Materialise Magics 29.1.1 Materialise Mimics Core (Medical) 2026 v28.0 MathWorks MATLAB R2025b v25.2.0.2998904 x64 Win MaxCut Business Edition 2.9.6.3 Maxon CINEMA 4D 2026.1.2 x64 Maxqda 26 MAXQDA Analytics Pro R26.0.0 x64 MecSoft RhinoCAM 2025 15.0.179 for Rhinoceros 8 -Mentor calibre 2024.2 Meteodyn WT 6.9.1 Metre2 Takeoff Studio Pro 1.1.5 MICRESS 7.2 Millbox 2025 MillBox DGSHAPE Edition V25.1.2 MITCalc v2.04 Molsoft ICM-Pro 3.9-4a x64 Multiecuscan 5.3R1 Multiquant 3.0.3 nanoSoft nanoCAD Scan 2025 v25.0.6962.4768 build 8019 NAPA 2024.2 NAPA designer 2025.1 NBL Landscape Designer 2025 25.0.5 NCSS Pro 2026 v26.0.1 x64 neostampa 25.12.1 NeuroScore 3.6 NijiCraft NijiCAD Pro v1.2.3 Normal Blood Parameters 1.0.1 NOZZLE PRO V25 nTopology 5.39.2 x64 Nubigon pro 7.3.2 Nucleomatica iNMR 7.0.5 ODEON 19.02 Combined OkMap Desktop 19.3.0 x64 OneSphere Technologies Pharmacy System 1.2.1.0 x64 OpenTower Designer 2024 (24.00.01.12) Operant Peak Spectroscopy 4.00.544 OptiLayer V2025.12 OPTIMOOR v6.8 Optiwave OptiSystem 2026 v23.0 orcaFlex 11.6a ORS Dragonfly 3d 2025.1 Palisade Risk Platform (DecisionTools Suite) 2025 v8.12 Pandat 2025 ParkSEIS 3.0 PASS START-PROF V4.87 R2 2025 Peloton WellView 9.0 PentaLogix CAMMaster Designer 11.24.73 PentaLogix ViewMate Pro 11.24.74 Pepakura Designer 6.1.4 Petroleum experts IPM Suite 13.5 phapro 8.21 PhotoPrint 25.3 PhysiCalc Pro 1.0.1 PIPE-FLO Professional PIPESTRESS 2025 Pixologic Zbrush 2026.1.1 x64 win+mac Plato 7.1 PointCab 4Archicad 3.0R2 PointCab 4BricsCAD 3.0 Polar Instruments Si9000e 2025 v25.01 Polar Instruments Speedstack 2025 v25.01 Pospac mms 9.4 Power Path (Power Line Design Software) 25.2 - 2025 -primewave2024.09, lc2024.09, sc12024.06, prime2024.09 ProfiCAD v13.4.2 progeCAD 2026 Professional 26.0.10.10 (x64) Progenesis QI 2.4 ProMax 6.0 PSASP 7.95 PSC SmartCtrl 2025.1 PSD-PEBL 2025 PTC Creo 11.0.7 x64 Multilingual PV Elite 28.0 2026 ASME 2025 qbasePlus_3.2_x64 Q-Dir 12.45 QForm UK 11.2 qinsy 2.7.10 Ranplan wirless pro 6.9 rapidlasso LAStools Suite 2025 build 23122025 Raqsoft YModel 1.3.8 Release 20260108 x64 RealWorks 2026.10 Remcom Wireless Insite 2025 v4.0 Remcom XGtd 3.1.2 Revive Faces 2.0.12 Revolutio CHECKPOLE v11.2.10, CHECKSTEEL v4.1.6, CHECKWIND v8.4.2 Robert McNeel & Associates Rhinoceros 8 SR27 v8.27.26019.1602 RoboDK x64 v5.9.6.25622 2026 RockWare PetraSim 2025.2 RockWare RockWorks 2025.7.31 Rocscience Phase2 v8.024 ROHR2 v33.1 Room Arranger 10.3.3.741 S.S. Papadopulos & Associates GroundWater Desktop v5.2.35 SAi Flexi 25.3 SAI Production Manager 25.3 Sante PACS Server PG v4.4.4 SAPIEN PowerShell Studio 2026 5.10.263 x64 SAPIEN Primalscript 2026 v8.1.223 x64 Scale Photo Up 2.0.12 SCC-64 v15.8.1 Schlumberger OLGA 2026.1.0 Schlumberger Pipesim 2026.1.0 Sciex Analyst 1.7.3 Sciex OS 4.0 -scl2025.03, prime2025.06, fusioncomplier 2025.06 Seequent Leapfrog Geo/Works/Energy 2025.3.0 Seequent Res3DInv Res2DInv 2025 sentaurus 2025 TCAD linux Sentaurus vX-2025.09 SES CDEGS Suite 20.0 SETCAD EDS PRO 4.0.0.16 SFTC DEFORM-2D/3D PREMIER14 Siemens Aprisa 2025.4 Linux Siemens Calibre 2024.1 (15.1) linux Siemens Custom IC(TannerTools) 2025.4 Win64/Linux64 Siemens Designcenter NX 2512.3200 Siemens mPower 2025.4 Linux Siemens NX 2506 Build 8101 (NX 2506 Series) Siemens Precision 2025.1 Linux Siemens Solid Edge 2026 MP02 x64 Siemens Solido Characterization Suite 2025.3.1 Linux Siemens Solido Design Environment 2025.2.3 Linux Siemens Solido IP Validation Suite 2025.3 Linux Siemens Solido Simulation Suite 2025.3 Linux Siemens Tessent 2025.1 Linux Sigasi Visual HDL Enterprise Edition 2025.3 silvaco TCAD 2025 SimaPro Craft 10.1.0.4 Developer Edition simerics mp+ 6.1.1 2025 SIMetrix 9.10w Simio Enterprise Edition v19.280.48282 x64 Simio RPS Edition 2025 v19.280 SimulationsPlus GastroPlus 10.1 SIMULIA PowerACOUSTICS 2026.0 Win/Linux64 SIMULIA PowerDELTA 2026.0 Win/Linux64 SIMULIA PowerFLOW suite 2026.0 Win64/Linux64 SIMULIA WASP-NET 2026.0 SIMULIA XFlow 2026.0 Win64/Linux64 SINT Srl XGSLab Pro 2025.1.9 SkyCAD Electrical Pro 1.3.64.19355 SmartCtrl Pro 2025.1 SoftGenetics Mutation Surveyor 5.1.2 Soil Quality Test 1.0.1 SolidWorks 2026 SP1.1 Full Premium x64 Sonnet Suites 19.52 SoundPLAN 9.1 2025 SpatialAnalyzer Ultimate 2025.1 SPEAG SEMCAD X Matterhorn 20.2.4 SpinFire Insight 2025.3.0 x64 SprutCAM ENCY 2025 SSI ShipConstructor 2026R3 Stampack Xpress 2025 Steel&Graphics TecnoMETAL 2022 build 22.0 Sumo v24.0.1 Sustainability Learning Dashboard 1.0.0 Synopsys QuantumATK V-2025.06 Synopsys 3DIC Compiler 2025.06 Synopsys Avalon 2025.06 Synopsys Certitude 2025.06 Synopsys Chamber Matching 2025.06 Synopsys CODE V 2025.06 Synopsys Core Synthesis Tools W-2024.09-SP1 Linux Synopsys coreTools 2025.06 Synopsys Custom Compiler 2025.06-SP1 Linux Synopsys Custom WaveView ADV 2025.06 Win/Linux64 Synopsys CustomCompiler vX-2025.06 Linux Synopsys DSO.ai (Design Space Optimization AI) vX-2025.06 Synopsys DVE 2025.06 Synopsys Embedit 2025.06 Synopsys ESP 2025.06 Synopsys Euclide 2025.06 Synopsys FineSim 2025.06 Synopsys Formality 2025.06 Synopsys Fusion Compiler 2025.06 Synopsys HSPICE 2025.06 Synopsys IC Compiler 2025.06 Synopsys IC Compiler II 2025.06 Synopsys IC Validator Workbench 2025.06 Synopsys ICE Speed Adaptor 2025.06 Synopsys Laker OA 2025.06 Synopsys LibCompiler vX-2025.06 Linux Synopsys Library Compiler 2025.06-SP3 Synopsys LightTools 2025.03 Synopsys LucidDrive 2024.03 Synopsys LucidShape 2025.06 Synopsys LucidShape CAA V5 Based 2025.06 Synopsys Milkyway Environment 2025.06 Synopsys NanoTime 2025.06 Synopsys PowerReplay 2025.06 Synopsys PrimeClosure 2025.06 Synopsys Primeclosure vX-2025.06 SP1 Linux64 Synopsys PrimeLib 2025.06 Synopsys PrimePower RTL 2025.06 Synopsys PrimeShield 2025.06 Synopsys PrimeSim Continuum(PrimeSim XA) 2025.06 Synopsys PrimeSim HSPICE 2025.06 Win/Linux Synopsys PrimeSim XA vX-2025.06 Linux Synopsys PrimeTime Suite 2025.06 Synopsys PrimeWave 2025.06(need Custom Compiler 2025.06) Synopsys PrimeWave Design Environment 2024.09 Synopsys ProGen 2025.06 Synopsys Proteus 2025.06 Synopsys ProteusWorkbench 2025.06 Synopsys PS Photonic System Tools 2025.06 Synopsys PS PIC Design Suite 2025.06 Synopsys PS RSoft Photonic Device Tools 2025.06 Synopsys PyCell Studio 2025.06 Synopsys QuantumATK vX-2025.05 Linux Synopsys QuantumATK vX-2025.06 Win64 Synopsys Quickcap vX-2025.06 Linux Synopsys Raphael FX 2025.06 Synopsys RTL Architect 2025.06 Synopsys Saber 2025.06 Synopsys SaberRD 2025.06 Synopsys Sentaurus Process Explorer 2025.06 Synopsys Silicon WorkBench 2025.06 Synopsys SiliconSmart ACE 2025.06 Synopsys Simpleware 2025.06 Synopsys S-Litho 2025.06 Synopsys S-Metro 2025.06 Synopsys SpyGlass vX-2025.06 SP1 Linux64 Synopsys StarRC 2025.06 Synopsys Synplify FPGA Design 2025.09 Synopsys Synthesis(Design Compiler) 2025.06 Synopsys System Studio 20245.06 Synopsys TCAD Sentaurus 2025.06 Synopsys TCAD Sentaurus PCM Studio 2025.06 Synopsys Testmax ale vX-2025.06 SP3 Linux Synopsys TestMAX Manager 2025.06 Synopsys TetraMAX ATPG 2025.06 Synopsys Timing Constraints Manager 2025.06 Synopsys TweakerSuite 2025.06 Synopsys VC SpyGlass 2025.06 Synopsys VCS All 2025.06 Synopsys VCS Verilog Simulator vX-2025.06 Synopsys Verdi vX-2025.06 Linux Synopsys virtual_proto 2025 -Synopsys: Tajima DG17 by Pulse Tech Earth Volumetric Studio 2026.1 Tech Soft 3D SpinFire Insight 2025.3.0 TechnoSoft AMETank 14.3.11 Tecplot 360ex + Chorus 2025 R2 (2025.2.0.81941) Tecplot Focus 2025 R2 v2025.2.0.81941 Tecplot RS 2025 R1 v2025.1.0.82070 TEKLYNX CODESOFT 2021 Teledyne PDS 4.4.6.9 TempoQuest AceCAST 2025 v4.3.1 Tensor Research Encom ModelVision 18.0.37 Terragen Professional 4.8.62 (x64) Terrasolid Suite 2026 (26.001) Thermo Scientific Compound Discoverer 3.5 2026 Thermo-Calc 2025b ticra tools 23.1 tnxTower 8.0 Topcon Office v.10.0 TOVOS Powerline V3.0.7 Trillium Technology ShowCase Workstation 6.7.0.5 Trimble Business Center v2025.20 Trimble Inpho Photogrammetry v16.0.1 Win64 Trimble realworks 2026.10 Trimble TILOS v11.1 Trimble Vico Office R6.8 TwinMesh 2025 VacTran v3.48 Valentin Software PVSOL Premium 2026 R3 v2026.3.2617 vcs_all_vX-2025.06-SP1 -VCS2025.06, verdi2025.06, hspice2025.06, wv2025.06 Vector PC-lint Plus 2025 VectorCAST 2025 Veeam Backup & Replication Enterprise Plus 13.0.1.180 202511 vhf DentalCAM 8.11 Vic-2D 7.2 Vic3D Vic-3D 10.0 Vicon Blade 3.4.1 Vicon Pegasus 1.2.2 Vicon Shogun Post 1.9 ViewMate Pro 11.24.74 VPIphotonics DesignSuite 11.5 Wasp 2026 v12.10 WASP-NET 2026 Wastewater Design Pro 1.0.1 WasteWater Factors 1.0.1 Wastewater Plant Design Pro 1.0.0 Waterloo AquaChem 2025 v14.0 Waterloo Visual.MODFLOW Flex Premium 2025 v11.0 Waters Progenesis QI World Creator 2026.1 WSV3 Pro v7.8 XGSLab 2025.1.9 (x64) XMind 2026 26.02.02052 win/mac Zebra CardStudio Professional 2.5.39.0 Zond Resistivity IP 2.5D ZondRes2D 8.0 Zond Resistivity IP 3D ZondRes3D 7.5 zorba Z-zero Z-planner Enterprise 2025.1 µWave Wizard 9.0 3DCoat 2025.17 x64 3DEqualizer4 Release 8.0v2 3DF Zephyr 8.037 3Dsurvey 4.0.2 x64 Aarhus Workbench v2025.1 Aberlink 3D 30.32.0.58 3D ACI Services eRCM Pro 2025 v1.29.1 ACI Services eRCM Thermo 2025 v1.11.4.0 ADAPT Builder 2019 b1 Win64 Adobe Premiere Elements 2026 v26.1 x64 Adobe Substance 3D Designer 15.1.0 x64 win/mac x64 Adobe Substance 3D Painter 11.1.1 x64 win/mac Advanced Logic Technology WellCAD v5.5 Agilent NovoExpress 1.6.3 Agisoft Metashape Pro v2.3.0.21868 x64/v2.0.4 Akcelik SIDRA Intersection 2025 v10.0.6.236 ALARMCAD 2025 Alibre Design Expert 28.1.1.28228 Win64 Altium Designer 26.1.1.7 x64 Ambiera CopperCube 6.7.4 x64 AnalysisPipeAPP PRI AUT2.0 ANGLE 5.0.0.480 Ansys Products 2025 R2.04 (SP4) Win / R1.02 (SP2) Linux Antidote 12 v3 win/mac AnyLogic Professional 8.9.7 x64 anyLogistix Professional 3.0 ANY-maze 7.54 Aquaveo Groundwater Modeling System(GMS)Premium 10.9.1 x64 Archelios CALC 2024 ArchiCAD 29.0.2.3200 Win/macOS + ArchiFrame 13.10.2023 Arivis Vision4D 3.5 ARM Development Studio 2025.1 Win/Linux Arm Keil MDK 5.43a ArtemiS SUITE 15.1 Artifact Interactive Garden Planner 3.8.81 Aspen Distriview 10.3 Aspix 4.6 Astrology House Janus 6.4.3 ATENA 5.7 Autoclean BeamworX v2025.1.1 Autodesk InfoDrainage Ultimate 2026.4.0 x64 Autodesk InfoWorks ICM Ultimate 2026.3 (x64) Autodesk InfoWorks WS Pro 2026.3 (x64) Autodesk Vault Products 2025.4 AUTOSPRINK 2025 AutoTURN v2025 Awesome Miner Ultimate 11.3.3 Bentley OpenPlant Orthographics Manager 2024 Bentley OpenPlant Project Administrator 2024 v24.00.03.10 Bentley ProStructures 2024 BIOVIA Pipeline Pilot 2026 v26.1.0.1865 x64 Boris FX Samplitude Suite 2025.0.3.25267 x64 BOSpulse 6.0.1 BowTieXP Advanced v12.0.8 BR&E ProMax 6.0 x64 Bricsys BricsCAD Ultimate v26.1.07 and PowerPath v25.2.08.Win64 Cadence Digital Design Implementation (DDI) System 25.10.000 Linux Cadence IC 25.10.030 Linux Cadence OrCAD X Platform 2025.1 HF010 v25.10.010 x64 Cadence Sigrity X Platform 2025.1 HF1 v25.10.100 x64 Cadence SPECTRE 25.10.054 Base Linux Cadence XCELIUM Main 25.03.001 Linux32_64 CALPUFF View 10.0 Cameo Enterprise Architecture 2026X CARIS HIPS and SIPS Pro 12.1.0 x64 CATIA DELMIA V5-6R2022 Catia Magic Systems 2026x HotFix1 (SysML v2) CEREC Premium CAM SW 4.4.3 CFTurbo v2026 R1.0.126 + CFTurbo FEA v2026 R1.0 x64 CGSim 11.1 Chaos Vantage 3.1.0 x64 CHCNAV CoProcess 2025 Chemcraft 2025 v1.8 Cimatron v2026 CIMCO Edit 2025 v25.01.24 x64 CivilGEO GeoHECRAS 3.1 HEC-RAS CLC Genomics Workbench Premium 26.0.1 x64 Clearedge3d EdgeWise 5.9.0 Cliosoft SOS 2025 Linux64 Cloanto C64 Forever 11.2.2 Plus Edition Code VBA 11.0.0.26 ColorGate PRO Rip Server 2025 COMET 3 CoProcess 2025 v.1.0.0 Coreform Cubit 2025.12 Win64 Craft Edge Sure Cuts A Lot Pro 6.079 Multilingual Crapfixer 1.30.243 Crosslight APSYS/PICS3D/CSUPREM 2024 Crystal Impact Diamond 5.1.1 Build 51 Crystal Impact Match 2.2.1 Build 315 CSChrom Plus CST Studio Suite 2026 SP1 windows/linux Cutting Optimization Pro 5.18.17.1 Cyclone FIELD 360 CYMCAP 9.0 REV 1 Datacolor Match Pigment Plus 4.0.2.6 Datamine Supervisor 2025 v9.1.1 DecisionTools Suite 8.12 Deep Excavation DeepFND 2025 v25.0.7.1 Deep Excavation RetainEX 2025 v25.0.7.7 DEFORM V14.0sp1 DEHNsupport Toolbox 3.201 dhi Mike zero / mike+ 2025 Diablo EZReporter complete 4.0 DIgSILENT PowerFactory 2025 Dirac 7.2.9121 DNASTAR Lasergene 18.0.1.5 DNV GL Phast Safeti v9.11 with kfx Dolphin imaging 12 Draftable Desktop 25.12.100 dragonfly v2025.1 DS CATIA DELMIA V5-6R2019 DSO.ai 2023.12 SP5 Linux DyRoBeS 2200 Earth Volumetric Studio v2025.6 EasyPower 2025 Eclipse Scientific BeamTool 10 eDrawings Pro Suite Revision 2025-12-2 Edwards PumpCalc v5.0 EEMS 12.4(EFDC+ Explorer 12.4.0 and Grid+ 1.3) Eh5Pro Shortcut 2025.5.20 EIVA NaviEdit 9.1.0 EIVA NaviModel Analyser 4.11.0 EIVA NaviModel Producer 4.11.0 EIVA NaviPac 4.11.0 EIVA NaviScan 9.9.0 Elec Calc 2024 Empyrean Aether Design Entry 2025.03 Linux Empyrean ALPS Simulator 2025.09 Linux Empyrean Argus DRC/LVS 2024.04 Linux Empyrean Skipper 2025.03.SP2 Linux32_64 EMTP (EMTPWorks) 4.5 Energy Exemplar PLEXOS Desktop 2025 v11.000 R03 Ensoft APILE 2023.10.5 Ensoft APILE Offshore 2023.10.5 Ensoft DynaMat 2018.3.2 Ensoft DYNA-N 3.0.15 Ensoft DynaPile 2016.3.2 Ensoft EnCPT 2019.1.5 Ensoft EnFEM 2019.1.1 Ensoft GeoMat 2022.3.1 Ensoft Group 2022.12.6 Ensoft LPile 2022.12.10 Ensoft PYWall 2022.7.7 Ensoft SETOFF 2020.4.3 Ensoft SHAFT 2023.9.3 Ensoft StablPro 2015.4.5 Ensoft TZPILE 2021.4.3 ESRI CityEngine 2025.1.11669 EthoVision XT 16.0 etx 12.5.2.8800 EViews Enterprise v.14 Exportizer Enterprise 10.2.7.642 Extreme Loading for Structures - ELS 8.0 x64 Faro scene 2025 Fast Video Cutter Joiner 6.9.5 FEM-Design Suite v24.00.004 x64 Figma 125.11.6 Win+mac Filou NC Gorilla 2025.11.18 Fonix Geosciense LIME v3.3.1 FonixGeo LIME v3.3.1 Win64 Frilo 2021 Futuremark 3DMark Professional 2.32.8743 Fuzor v2026 build 50823 Gas Turbine Simulation Program - GSP 12.0.4.2 GastroPlus 10.2 v2025 x2 GasTurb Smooth C/T 8.2 GateCycle 6.1.4 Geekbench AI Corporate 1.6.0 GeoGebra 6.0.909.9 geogiga seismic Pro 8.3 Geometric Glovius Premium 6.7.0.120 geomodelling R2022b 9.1 geoplatai v2025.03 GeoReservoir Research 7.0 GEOSoft Oasis Montaj 2025.1 Geostatistics ISATIS.NEO Mining Edition 2025.1 GeoticCAD v1.11.5 GeoticLog v8.2.18 GeoticMine v1.4.13 GeoticSection v1.0.13 GEOVIA MineSched 2026 x64 GEOVIA Surpac 2026 GEOVIA Whittle 2026 Gerber17.0 AccuMark V2024.1 GerbView v11.33.0.637 x86/x64 gexcel reconstructor 4.4.1 Gexcon Shell FRED v7.1.1 Golden Software Grapher 26.1.314 GOM Software 2022 Graphisoft Archicad 28.3.0 Multilanguage MacOS GRAPHISOFT ArchiCAD 29.0.2 Build 3200 win/mac+Archiframe Graphisoft MEP Designer 29.0.2 x64 GravoGraph Gravostyle 6.0 GstarCAD 2026.1 Professional + Mechanical 2025 Gstarsoft GstarCAD Pro 2026 SP1 build 251031 Win64 GTsuite 2025 Gurobi 13.0.0 HazMap3D v23 HDExaminer 3.42 Helium Music Manager 17.4.551 Premium Hexagon Leica MinePlan 2025 R1 (16.5.0) Hexagon PPM COADE PV Elite 27 U2 HIERARCHICAL LINEAR MODELS HLM v8.2 HighScore plus 5.3 hsbDesign for AutoCAD v.29.0.10 HSPiP 6.1 HxGN MinePlan 2025.1 Release 1 x64 HydroComp NavCad PropCad propelement PropExpert 2023 Hydromantis GPS-X 8.1.1/Toxchem /CapdetWorks/WatPro 4.0 HyperSpec III 3.1.4 IBM Engineering Rhapsody v10.0.2 Win64 IDEA StatiCa 25.1.2.1278 IDimager Photo Supreme 2025.3.3.8139 IES QuickMasonry v6.00.0009 IES VE Virtual Environment 2025 IHS Harmony Enterprise 2024.1 IHS SubPUMP 2024.1 IK Multimedia AmpliTube 5 Complete v5.10.9 Image-Pro 10.0.10 InkFormulation Manufacturer v6.6.3 Innomar ISE v2.9.5 INSUL 9.0 Intelligent Light FieldView 25.0 Intergraph TANK v14.00 Intetech Electronic Corrosion Engineer (ece) 5.8.0 intrepid 6.5 Intuit QuickBooks Enterprise Solutions 2024 R18 + Accountant/macOS IP Decryptor v15.1 IPS CaseDesigner 2.5.7.1 IRIS.Instruments.Electre.Pro.2020.build.02.09.01 iSolarTool Itasca software ( pfc3d/3dec/flac3d/massflow) 9.10.7 itech ACORD v.6.4.1 JangaFX GeoGen 0.5.3 (x64) JangaFX IlluGen 1.1.1 (x64) JangaFX LiquiGen 1.0.5 x64 Jeppesen Cycle DVD 2601 Full World JewelSuite GeoMechanics 2018.1 JMatPro 14.1 Jupiter-BLS +Jupiter-Post 1.0 KAPPA Workstation 5.40 Keil MDK v5.43a + DFP / C51 v9.61 / C166 v7.57 / C251 v5.60 Keysight PathWave Advanced Design System (ADS) 2026 Update 1 Win/Linux KiCad v9.0.7 Win/macOS KONGSBERG K-Spice SimExplorer 4.8 KONGSBERG LedaFlow Engineering 2.8 + Multiflash v6.2 Krita Studio 5.2.14 x64 LDRA Tool Suite Testbed 10.3.0 LEADTOOLS 23 Leapfrog Works v2025.3 Leica CloudWorx 2025.2 For Revit 2023-2026 Leica CloudWorx for AutoCAD v2025.2.0 Leica CloudWorx For Revit 2025.2.0 Leica Cyclone 3DR 2025.2.2 Leica Hexagon MinePlan 2025 R1 v16.5.0 Leica Infinity v5.0 Leica Pegasus OFFICE v2024.2.1.116 Lhasa Nexus 2.7 lighttools 2024 Logosys Playout Expression 6.103 LuBan 3D v11.12.2025 LucidDrive2024 LucidShape 2024.09 MacroFocal 2024.09 Manatee 2025 Maptek Vulcan 2025.3 MASTA 15.0 Materialise Mimics Core Medical 28.0 with 3-Matic 20.0 MedCalc 23.4.5 MedCalc Digimizer 6.5.0 MedeA 3.10.0 Mentor Graphics Calibre 2025.1 Linux mentor mpower 2025 Mestrelab Research Mnova v16.0.0.39276 Win/macOS Meta Imaging Series MetaMorph 7.10.5 MHJ-Software PLC-Lab Pro v3.3.0 Microsoft Power BI Report Server September 2025 v15.0.1119.121 Microsoft Safety Scanner 1.443.436 MicroVision Suite 4.13 midas building 2026 MIDAS CIM + Drafter 2026 midas civil NX 2026 midas design+ 2026 midas dshop 2026 midas FEA NX 2026 midas gen 2026 MIDAS GeoXD 2026 midas GTS NX 2026 midas MeshFree 2026 midas midas cdn 2026 midas NFX 2026 midas nGen 2026 midas ngen&drawing 2026 midas smartBDS 2026 midas soilworks 2026 midas XD 2026 MIKE Zero 2025+mike+ 2025 mike+ Millbox 2025 MillBox Aidite v25.0.6 (2025) MindSched 2023 Refresh 1 MIPAR 5.3 MISTRAS Noesis MITCalc v2.03 MODELCENTER 2025R2 25.2 modri planet d.o.o.3Dsurvey v4.0.2 MODUSPlanningSuite-NoMedia_1.1.1.108 Molsoft ICM-Pro 3.9-4a x64 MOSAID TCS 11.4 MountainsMAP 10.3 MSC Simufact Forming 2025.3 (512 Cores upon) NCG CAM 20.0.02 NemoStudio 2022 neoStampa 25.7 Neuralog Desktop 2025 Neurolucida 360 2020.1 NeuroScore 3.6.0 Nevercenter Silo 2026.0 NewBlue Captivate 5.10 2025 Nis-Elements AR+BR+D V5.41 Nis-Elements AR-BR-SE HC V6.01 Noisesystem V4.5 nonmem v7.5 + pirana v3.0 nTopology 5.37.3 x64 NUBIGON Pro 7.3.1 OCCT 15.0.11.99 x64 Odeon 19.02 OIM Analysis 9.0 OLYCIA m3 22.3.8.15 OLYMPUS cellSens Dimension 2.3 OmniSEC 5.12 OmniSLAM Works Onyx Production House 2021 Openwind 2025 Operant Peak Spectroscopy 4.00.538 OptiLayer V2025.11 Optiwave OptiSystem 2025 v22.5 Orcaflex v11.6a OrthoGen v23 PathWave Advanced Design System (ADS) 2026 PCB DipTrace 5.2.0.4 x64 PEAKS GlycanFinder 3.0 PEAKS Studio 13.1 Pentacam 1.25 r15 PentaLogix CAMMaster Designer 11.24.72 PentaLogix ViewMate Pro 11.24.72 Pepakura Designer 6.1.3 Petroleum experts IPM Suite 13.5 PETROSYS Pro 2024 Photopia 2023.0.12140 PhotoPrint 25.3 PipelineStudio 5.2 PiX4Dmatic 1.83 Pix4DSurvey 1.83 Pixologic Zbrush 2026.1.1 x64 Planmeca Romexis 6.4.8 Plasticity 25.2.8 x64 PLC-Lab Pro 3.3.0 Plexim Plecs Standalone v4.9.8 Windows_ & Linux Plexon Offline Sorter x64 V4 PLEXOS 2025 v11.000 R03 /2026 x64 PMI Suite x64(Byos and Byosphere)v5.11.27 PMi-Byos Byonic 5.10 PointCab Origins v4.2 R18 Polar Instruments Si9000 2025 v25.04.16 Win32 Polar Instruments Si9000 25.01.01 + Speedstack 21.11.01 POSPac MMS 9.4 PostgreSQL Maestro 25.9.0.1 Power Path 25.2 PowerFlow 2026 Windows/Linux PRG 2025.4.0 Prinergy Evo 11 Production Manager 24.1.0 ProfiCAD v13.3.9 ProgeCAD 2026 Professional 26.0.10.10 x64 PROOSIS 6.2 ProtaStructure Suite Enterprise 2025 v8.0.217 PSE gPROMS Suite 2023 PSS SINCAL Platform 21.5 x64 PTV VISSIM 2025 PV Elite V28 2026 support ASME 2025 PV*SOL Premium 2025 R2 PVcase 2.13 PVSyst 8.0.6 Q-Dir 12.43 QForm 12.0 QIAGEN CLC Genomics Workbench 26.0.1 x64 Qimera 2.7.6 Qlucore Omics Explorer 3.8.17 QPS Fledermaus 8.7.0 QPS Qinsy 9.6.5 QuadriSpace Document3D Enterprise 2025 SP0.2 x64 Quick Gantt Chart 1.0.76 Quicken WillMaker & Trust 26.1.3127 R&S ES-SCAN RealCADD 5.70 ReliaSoft 2024.2 Reportizer 6.6.1.405 Multilingual Res3DInv & Res2DInv v2025.2 Rhinoceros 8.26.25349.19001 Windows/macOS RIEGL RiMINING v2.8 Riegl Riscan Pro 2.16 Riegl RiSOLVE v2.7.1 RIEGL RiWORLD 6.1 RiHYDRO v1.8.7 RiKinematicLiDAR 1.9.2 RiMINING v2.8 Riprocess1.9.2 RISA-3D 2019 V17 Riscan pro 2.16 Roberts Geospatial Engineering ProRaster Scientific 4.0.10 Robotmaster v6 Rocscience Dips 8.0 Rocscience EX3 v1.0 x64 Rocscience RocFall3 v1.009 Rocscience RocSlope2 v1.004 Rocscience RocSlope3 1.003 Rocscience RocTopple 2.005 Rocscience RocTunnel3 v1.002 Rocscience RS2 v11.0 x64 Rocscience RS3 v4.0 Rocscience Slide2 v9.020 Rocscience Slide3 v3.018 Rocscience Unwedge 5.0 RocTunnel3 v1.002 x64 Rodin4D Neo 2018 v10.2 ROHR2 v33.1 Room Arranger 10.3.1.737 S&P Global QUE$TOR 2025 Q3 SAi Flexi 25.3 Sante DICOM Editor v10.3.1 + Sante DICOM Editor 3D v4.9.4 Sante DICOM Viewer Pro v14.3.1 + Sante DICOM Viewer 3D Pro v4.9.4 Sante PACS Server PG v4.4.3 SAPIEN PowerShell Studio 2025 5.9.262 x64 SAPIEN Primalscript 2025 v8.1.222 x64 Schlumberger OFM 2025 Schlumberger OLGA 2026.1.0 Schlumberger Petrel 2024.6 Schlumberger PIPESIM 2026.1.0 Schlumberger Techlog 2024.2 Schlumberger VISTA 2025 SCIGRESS Suite 3.4.2 SDCImport v3.1 Seequent Leapfrog Geo v2025.3 SeisImager 2025 SeismoSoft Seismo Suite 2026 Release-1 Build-1 x64 Sequence Generator Pro 4.5.0.1554 Serato Studio 2.5.0 x64 SES CDEGS 20.0 SharpCap Pro 4.1 Siemens Aprisa P&R 2025.4 Linux64 Siemens Calibre 2025.2 (14.11) with Documentation Siemens Designcenter NX 2512.1700 (NX 2512 Series) Siemens mPower EMIR 2025.4 Linux64 Siemens NX 2512 Build 1700 x64 + Add-Ons Siemens Simatic TIA Portal V21 (2025_11) Siemens Simcenter 3D 2506 Siemens Simcenter FEMAP 2512 x64 with NX Nastran Siemens Simcenter FloEFD 2512.0.0 v6992 Siemens Solido Design Environment 2025.2.3 Linux64 Siemens Star CCM+ 2510 Siemens Tanner 2025.4 Win64 & Linux64 SIGERSHADERS XS Material Presets Studio 7.6.0 for 3ds Max Simapro 10.1 SimaPro Craft 10.2 Simerics-MP+ V6.1.2 (Win+Linux) 2025 SIMPACK 2026 Simple Cutting Software X 2025.11.30.0 Win32_64 Simplebim v11.0 SR6 Simpleware 2025.06 Sinovation12.0 SINT Srl XGSLab Pro 2025.1.9 SketchUp Pro 2026 v26.1.189 x64 SKM GroundMat 2.0.22 SKM Power Tools 11.0 SKM PTW 11.0.0.2 SkyCAD Electrical Pro v1.3.63.24343 S-Litho 2024 Smap3D Plant Design 2025 SP1 SMART INSTRUMENTATION V14 Smart MindMap 11.1.0 SmartCtrl Pro 2024.1 Smile Designer Pro v3.4.3 Software Ideas Modeler Ultimate 15.20 SpaRISK 1.0.0.0 Sparkta 3.1 Sparkta-Lightning-Aspix Spectronaut 20.1 SSD Booster .NET 18.45 SSI ShipConstructor 2026R3 Stampack Xpress 2025 Steelray Project Analyzer 7.22 Stellarium Astronomy Software 25.4 STM32CubeMX 6.16 + PACKS StrategyQuant X Pro Build 143 (Full license) StructurePoint spMats v10.50 StruSoft FEM-Design Suite 24.00.005 Surpac 2026 Symetri Naviate for Autodesk Civil3D 2025 Symetri Naviate for Autodesk Revit 2026 Synopsys 3DIC-Compiler vV-2023.12 Linux64 Synopsys Design Compiler vX-2025.06 SP4 Linux Synopsys FineSim vW-2024.09-SP2 Linux Synopsys Formality vV-2025.06 Linux Synopsys HSPICE 2021.09 / Saber P-2019.06 Win/ L-2016.06-SP1 Linux Synopsys Icvalidator vX-2025.06 Linux64 Synopsys LucidShape 2024 Synopsys Mono Slayer 25.11 Linux Synopsys Tweakersuite vX-2025.06 SP2 Linux64 Synopsys vcs 2025 Synopsys VCS Verilog Simulator vX-2025.06 Linux Synopsys verdi 2025 TechnoSoft AMETank v18.9.22 Tecplot FieldView 2025 build 12.02.2025 Win64 Tekla Structures 2025 SP6 x64 Teledyne PDS Tensor Research Encom ModelVision 18.0.37 Terragen Professional 4.8.62 (x64) Thermo-Calc 2025b ThermoSientific AMIRA/AVIZO 3D 2025.1.1 x64 ThinkAutomation Studio Professional Edition 5.1.1100.2 ThinkDesign pro 2019.1 for win11 tNavigator 2025.3 x64 Topcon Office v.10.0 TopoFlight Mission Planner v2024.0.1.3 Tower Numerics tnxFoundation v1.1.0.5 TrainController Gold 10.0 B3 Transoft AutoTURN Pro 3D v9.0.3.316 Transoft Solutions AutoTURN 2025.12 Trimble Business Center TBC 2024.1 Trimble eCognition Developer v10.4 Trimble realworks 2025.11 Trimble Tekla Structures 2025 SP6 x64 Trimble TILOS v11.1 TubePro v6.1 R1 2033 TwinMesh 2025 UcamX SmartPlot SmartTest Undet for Revit 2026 Vactran v3.49 Valentin Software GeoTSOL 2026 R1 v2026.1.13 Valentin Software PV*SOL PVSOL premium 2026 R1 Valentin-PV-2022-R5 Veesus Arena4D Data Studio Professional 9.5 Vic-2D VIC-Snap 10 ViewCompanion Premium 16.24.0.1118 X64 Virtual DMIS 5.0 VirtualLab Fusion 2024 visionCATS 3.2 sp2 VisionLidar 2025 VitasEM v2.3 VPI 11.6 Wasp 2025 Wave6 2025 WaveMetrics Igor Pro 10.00.29815 WaveView HSPICE windPRO v4.1.254 winglink 2.21.08 WinSwitch3 WinUAE 6.0.2 WipWare WipFrag 4.0.52 WirelessMon 5.0 WormLab 2024.1.1 XenoDream Jux v4.803 xflow2026 XGSLab 2025.1.9 ZEISS arivis Pro 4.2 ZEISS GOM Software 2022 ZEISS Quality Suite Zeiss Zen 3.7 Zeiss Zen Blue 3.3 ZMT Sim4Life 9.0 ZWSIM Structural 2026 Anything you need, just email to: crdlink#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: crdlink#hotmail.com change # into @ RE: NAPA designer 2025.1 - yokemhard - 03-27-2026 Dres665BettBettMariDaviStanотноSecrKaurцветЗадоRudyTescтексFunnLongwildтексХрапрезьфашиПорт RondRoseПалиNoraоборRogeрассGuilBarrМаркBangBaccмагнЛодкчитаязыкСодеПтахAnneSCP-AtlaMichlear CotoКрылсертОгарЛибеXVIIБрайКостДемиШомасемиSelaиллюFallKanwSaifАксеFritАксеGaryJuliPushSwee JohnSieLмолнMODOCircElegTraiSideElegAccoZoneRondSelaдопоShorФСкоКудрВенеLuciСодеRichJohnШкар AlanZoneThelВасичастZoneMORGZoneZone03-0ZoneZoneZoneZoneZone2254караZoneZoneZoneZoneZoneZone ZoneукрахороKOSSDuroWhirKronROKRBookПодвBookРоссLeifVani00001522Tain9148SEATуказСавчстатCoun ИллюValibonuпредsteaгранАнтоСоснWindWindJuliPartсертШтыкEukaqбгсРазмклубStanКочеЛитРЛитРЛитР Смет(194ScotНезапериMartЕршоЛебе(186HeinСмиртеатЛюбоMagiSingНеокauthжизнполечитаVivaComeАлек класшколSaleИллюОзеррепкХохлДробКрасEnglRobeЕлисКостРуднУшакIronГолдHarvРаутСокоreviKOSSKOSS KOSSUnhoLookCindслушHuncSweeJaneИгошВесеSaraWordЗуевtuchkasСолонача RE: NAPA designer 2025.1 - yokemhard - 05-28-2026 geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions |